Defensin alpha1 Antibody - #DF8527
Product: | Defensin alpha1 Antibody |
Catalog: | DF8527 |
Description: | Rabbit polyclonal antibody to Defensin alpha1 |
Application: | WB IHC |
Reactivity: | Human, Mouse |
Mol.Wt.: | 10 kDa; 10kD(Calculated). |
Uniprot: | P59665 |
RRID: | AB_2841731 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8527, RRID:AB_2841731.
Fold/Unfold
DEF1; DEF3; DEFA1; DEFA2; DEFA3; Defensin alpha 1; Defensin alpha 2; Defensin alpha 3; HNP1; HNP3; HP1; HP3; MRS; Neutrophil defensin 1; Neutrophil defensin 2; Neutrophil defensin 3;
Immunogens
- P59665 DEF1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC
PTMs - P59665 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y67 | Phosphorylation | Uniprot | |
Y80 | Phosphorylation | Uniprot | |
T82 | Phosphorylation | Uniprot | |
C83 | S-Nitrosylation | Uniprot | |
Y85 | Phosphorylation | Uniprot |
Research Backgrounds
Defensin 1 and defensin 2 have antibacterial, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane.
ADP-ribosylation drastically reduces cytotoxic and antibacterial activities, and enhances IL8 production.
Phosphorylation at Tyr-85 has been found in some cancer cell lines, and interferes with ADP-ribosylation.
Secreted.
Dimer. Interacts with RETN.
Belongs to the alpha-defensin family.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.