COLQ Antibody - #DF8523
| Product: | COLQ Antibody |
| Catalog: | DF8523 |
| Description: | Rabbit polyclonal antibody to COLQ |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Chicken |
| Mol.Wt.: | 47 kDa; 48kD(Calculated). |
| Uniprot: | Q9Y215 |
| RRID: | AB_2841728 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8523, RRID:AB_2841728.
Fold/Unfold
Acetylcholinesterase collagen-like tail subunit isoform I; Acetylcholinesterase collagenic tail peptide; Acetylcholinesterase collagenic tail peptide precursor; Acetylcholinesterase-associated collagen; AChE Q subunit; asymmetric acetylcholinesterase; Collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase; Colq; COLQ_HUMAN; EAD; OTTHUMP00000209566; OTTHUMP00000209567; single strand of homotrimeric collagen-like tail subunit of asymmetric acetylcholinesterase;
Immunogens
- Q9Y215 COLQ_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVVLNPMTLGIYLQLFFLSIVSQPTFINSVLPISAALPSLDQKKRGGHKACCLLTPPPPPLFPPPFFRGGRSPLLSPDMKNLMLELETSQSPCMQGSLGSPGPPGPQGPPGLPGKTGPKGEKGELGRPGRKGRPGPPGVPGMPGPIGWPGPEGPRGEKGDLGMMGLPGSRGPMGSKGYPGSRGEKGSRGEKGDLGPKGEKGFPGFPGMLGQKGEMGPKGEPGIAGHRGPTGRPGKRGKQGQKGDSGVMGPPGKPGPSGQPGRPGPPGPPPAGQLIMGPKGERGFPGPPGRCLCGPTMNVNNPSYGESVYGPSSPRVPVIFVVNNQEELERLNTQNAIAFRRDQRSLYFKDSLGWLPIQLTPFYPVDYTADQHGTCGDGLLQPGEECDDGNSDVGDDCIRCHRAYCGDGHRHEGVEDCDGSDFGYLTCETYLPGSYGDLQCTQYCYIDSTPCRYFT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9Y215 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S100 | Phosphorylation | Uniprot | |
| S169 | Phosphorylation | Uniprot | |
| S175 | Phosphorylation | Uniprot | |
| Y178 | Phosphorylation | Uniprot | |
| S181 | Phosphorylation | Uniprot | |
| R182 | Methylation | Uniprot | |
| K191 | Ubiquitination | Uniprot |
Research Backgrounds
Anchors the catalytic subunits of asymmetric AChE to the synaptic basal lamina.
The triple-helical tail is stabilized by disulfide bonds at each end.
Cell junction>Synapse.
Found at the end plate of skeletal muscle.
Homotrimer. Component of the asymmetric form of AChE, a disulfide-bonded oligomer composed of the collagenic subunits (Q) and a variable number of asymmetric catalytic subunits (T). The N-terminal of a collagenic subunit (Q) associates with the C-terminal of a catalytic subunit (T).
The proline-rich attachment domain (PRAD) binds the AChE catalytic subunits.
Belongs to the COLQ family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.