LMAN1 Antibody - #DF8460
Product: | LMAN1 Antibody |
Catalog: | DF8460 |
Description: | Rabbit polyclonal antibody to LMAN1 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Zebrafish, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 58 kDa; 58kD(Calculated). |
Uniprot: | P49257 |
RRID: | AB_2841696 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8460, RRID:AB_2841696.
Fold/Unfold
Endoplasmic reticulum golgi intermediate compartment protein 53; ER-Golgi intermediate compartment 53 kDa protein; ERGIC-53; ERGIC53; ERGIC53 like protein; F5F8D; FMFD1; Gp58; Intracellular mannose specific lectin; Intracellular mannose-specific lectin MR60; Lectin mannose binding 1; Lectin mannose-binding 1; Lman1; LMAN1 like protein; LMAN1_HUMAN; MCFD1; MR60; Protein ERGIC-53;
Immunogens
- P49257 LMAN1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAGSRQRGLRARVRPLFCALLLSLGRFVRGDGVGGDPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQRRYVSSLTEEISKRGAGMPGQHGQITQQELDTVVKTQHEILRQVNEMKNSMSETVRLVSGMQHPGSAGGVYETTQHFIDIKEHLHIVKRDIDNLVQRNMPSNEKPKCPELPPFPSCLSTVHFIIFVVVQTVLFIGYIMYRSQQEAAAKKFF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P49257 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K49 | Ubiquitination | Uniprot | |
K87 | Ubiquitination | Uniprot | |
T276 | O-Glycosylation | Uniprot | |
K302 | Ubiquitination | Uniprot | |
S325 | Phosphorylation | Uniprot | |
K346 | Ubiquitination | Uniprot | |
K372 | Ubiquitination | Uniprot | |
T385 | O-Glycosylation | Uniprot | |
K407 | Ubiquitination | Uniprot | |
S425 | O-Glycosylation | Uniprot | |
S425 | Phosphorylation | Uniprot | |
Y430 | Phosphorylation | Uniprot | |
T432 | O-Glycosylation | Uniprot | |
T433 | O-Glycosylation | Uniprot | |
K440 | Ubiquitination | Uniprot | |
K447 | Ubiquitination | Uniprot |
Research Backgrounds
Mannose-specific lectin. May recognize sugar residues of glycoproteins, glycolipids, or glycosylphosphatidyl inositol anchors and may be involved in the sorting or recycling of proteins, lipids, or both. The LMAN1-MCFD2 complex forms a specific cargo receptor for the ER-to-Golgi transport of selected proteins.
The N-terminal may be partly blocked.
Endoplasmic reticulum-Golgi intermediate compartment membrane>Single-pass type I membrane protein. Golgi apparatus membrane>Single-pass membrane protein. Endoplasmic reticulum membrane>Single-pass type I membrane protein.
Ubiquitous.
Exists both as a covalent disulfide-linked homohexamer, and a complex of three disulfide-linked dimers non-covalently kept together. Interacts with MCFD2. May interact with TMEM115. Interacts with RAB3GAP1 and RAB3GAP2. Interacts with UBXN6.
The FF ER export motif at the C-terminus is not sufficient to support endoplasmic reticulum exit, and needs assistance of Gln-501 for proper recognition of COPII coat components.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > Protein processing in endoplasmic reticulum. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.