ARF5 Antibody - #DF8451
| Product: | ARF5 Antibody |
| Catalog: | DF8451 |
| Description: | Rabbit polyclonal antibody to ARF5 |
| Application: | WB IHC |
| Reactivity: | Human |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Chicken |
| Mol.Wt.: | 20 kDa; 21kD(Calculated). |
| Uniprot: | P84085 |
| RRID: | AB_2841691 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8451, RRID:AB_2841691.
Fold/Unfold
ADP ribosylation factor 5; ADP-ribosylation factor 5; ARF 5; Arf5; ARF5_HUMAN;
Immunogens
- P84085 ARF5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P84085 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| G2 | Myristoylation | Uniprot | |
| T4 | Phosphorylation | Uniprot | |
| S6 | Phosphorylation | Uniprot | |
| S10 | Phosphorylation | Uniprot | |
| Y35 | Phosphorylation | Uniprot | |
| K36 | Acetylation | Uniprot | |
| K36 | Ubiquitination | Uniprot | |
| K38 | Ubiquitination | Uniprot | |
| Y58 | Phosphorylation | Uniprot | |
| K73 | Sumoylation | Uniprot | |
| S103 | Phosphorylation | Uniprot | |
| R117 | Methylation | Uniprot | |
| K127 | Ubiquitination | Uniprot | |
| S137 | Phosphorylation | Uniprot | |
| T140 | Phosphorylation | Uniprot | |
| K142 | Ubiquitination | Uniprot | |
| C159 | S-Nitrosylation | Uniprot |
Research Backgrounds
GTP-binding protein involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.
(Microbial infection) Functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase.
Golgi apparatus. Cytoplasm>Perinuclear region. Membrane>Lipid-anchor. Golgi apparatus>trans-Golgi network membrane>Lipid-anchor.
Interacts (when activated) with GGA1, GGA2 and GGA3; the interaction is required for proper subcellular location of GGA1, GGA2 and GGA3. Binds ASAP2. Interacts with NCS1/FREQ at the Golgi complex. Interacts with RAB11FIP3 and RAB11FIP4.
Belongs to the small GTPase superfamily. Arf family.
Research Fields
· Cellular Processes > Transport and catabolism > Endocytosis. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.