MGLL Antibody - #DF8444
| Product: | MGLL Antibody |
| Catalog: | DF8444 |
| Description: | Rabbit polyclonal antibody to MGLL |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 33 kDa; 33kD(Calculated). |
| Uniprot: | Q99685 |
| RRID: | AB_2841687 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8444, RRID:AB_2841687.
Fold/Unfold
EC 3.1.1.23; HU K5; HU-K5; HUK5; Lysophospholipase homolog; Lysophospholipase like; Lysophospholipase-like; MAGL; MGL; MGLL; MGLL_HUMAN; Monoacylglycerol lipase; Monoglyceride lipase;
Immunogens
- Q99685 MGLL_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q99685 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T10 | Phosphorylation | Uniprot | |
| K36 | Ubiquitination | Uniprot | |
| K188 | Ubiquitination | Uniprot | |
| T189 | Phosphorylation | Uniprot | |
| S196 | Phosphorylation | Uniprot | |
| Y248 | Phosphorylation | Uniprot | |
| S301 | Phosphorylation | Uniprot |
Research Backgrounds
Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain. Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth.
Cytoplasm>Cytosol. Membrane>Peripheral membrane protein.
Detected in adipose tissue, lung, liver, kidney, brain and heart.
Homodimer.
Belongs to the AB hydrolase superfamily. Monoacylglycerol lipase family.
Research Fields
· Metabolism > Lipid metabolism > Glycerolipid metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
· Organismal Systems > Nervous system > Retrograde endocannabinoid signaling. (View pathway)
· Organismal Systems > Endocrine system > Regulation of lipolysis in adipocytes.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.