RAE1 Antibody - #DF8442
Product: | RAE1 Antibody |
Catalog: | DF8442 |
Description: | Rabbit polyclonal antibody to RAE1 |
Application: | WB IHC |
Reactivity: | Human |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Dog, Chicken, Xenopus |
Mol.Wt.: | 41 kDa; 41kD(Calculated). |
Uniprot: | P78406 |
RRID: | AB_2841686 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8442, RRID:AB_2841686.
Fold/Unfold
dJ481F12.3; dJ800J21.1; FLJ30608; Homolog of yeast Rae1 (Bharathi) mRNA associated protein of 41 kDa (Kraemer); Homolog of yeast Rae1 mRNA associated protein of 41 kDa; MGC117333; MGC126076; MGC126077; MIG 14; MIG14; Migration inducing gene 14; Mnrp 41; Mnrp41; mRNA associated protein mrnp 41; mRNA binding protein 41 kD; mRNA export factor; mRNA export protein; mRNA-associated protein mrnp 41; MRNP 41; MRNP41; RAE 1; RAE1 (RNA export 1 S.pombe) homolog; rae1; RAE1 homolog; Rae1 protein homolog; RAE1 RNA export 1 homolog (S. pombe); RAE1 RNA export 1 homolog; RAE1L_HUMAN; RNA export 1; RNA export 1 homolog;
Immunogens
- P78406 RAE1L_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSLFGTTSGFGTSGTSMFGSATTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P78406 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T12 | Phosphorylation | Uniprot | |
K80 | Ubiquitination | Uniprot | |
K100 | Ubiquitination | Uniprot | |
K108 | Acetylation | Uniprot | |
K108 | Ubiquitination | Uniprot | |
K111 | Ubiquitination | Uniprot | |
K131 | Acetylation | Uniprot | |
K131 | Ubiquitination | Uniprot | |
K151 | Ubiquitination | Uniprot | |
K154 | Ubiquitination | Uniprot | |
S160 | Phosphorylation | Uniprot | |
Y180 | Phosphorylation | Uniprot | |
S209 | Phosphorylation | Uniprot | |
K212 | Methylation | Uniprot | |
K212 | Ubiquitination | Uniprot | |
K222 | Ubiquitination | Uniprot | |
K224 | Ubiquitination | Uniprot | |
K227 | Ubiquitination | Uniprot | |
T229 | Phosphorylation | Uniprot | |
K252 | Acetylation | Uniprot | |
K252 | Ubiquitination | Uniprot | |
K258 | Methylation | Uniprot | |
K258 | Ubiquitination | Uniprot | |
Y274 | Phosphorylation | Uniprot | |
K302 | Ubiquitination | Uniprot | |
K309 | Ubiquitination | Uniprot | |
Y345 | Phosphorylation | Uniprot | |
K349 | Ubiquitination | Uniprot | |
K350 | Ubiquitination | Uniprot | |
R356 | Methylation | Uniprot | |
K363 | Ubiquitination | Uniprot |
Research Backgrounds
Plays a role in mitotic bipolar spindle formation. Binds mRNA. May function in nucleocytoplasmic transport and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton.
Cytoplasm. Nucleus. Cytoplasm>Cytoskeleton>Spindle pole.
Note: Recruited from interphase nuclei to spindle MTs during mitosis.
Interacts with NUMA1 (via N-terminal end of the coiled-coil domain); this interaction promotes spindle formation in mitosis. Interacts with NUP98. Interacts with MYCBP2.
Belongs to the WD repeat rae1 family.
Research Fields
· Genetic Information Processing > Translation > RNA transport.
· Human Diseases > Infectious diseases: Viral > Influenza A.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.