ICOSLG Antibody - #DF8422
Product: | ICOSLG Antibody |
Catalog: | DF8422 |
Description: | Rabbit polyclonal antibody to ICOSLG |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse |
Mol.Wt.: | 33~70 kDa; 33kD(Calculated). |
Uniprot: | O75144 |
RRID: | AB_2841670 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8422, RRID:AB_2841670.
Fold/Unfold
B7 H2; B7 homolog 2; B7 homologue 2; B7 like protein Gl50; B7 related protein 1; B7-H2; B7-like protein Gl50; B7-related protein 1; B7H2; B7RP 1; B7RP-1; B7RP1; CD 275; CD275; CD275 antigen; GL 50; GL50; ICOS L; ICOS LG; ICOS ligand; ICOSL; ICOSL_HUMAN; Icoslg; Inducible T cell co stimulator ligand; KIAA0653; LICOS; Transmembrane protein B7 H2 ICOS ligand;
Immunogens
Isoform 1 is widely expressed (brain, heart, kidney, liver, lung, pancreas, placenta, skeletal muscle, bone marrow, colon, ovary, prostate, testis, lymph nodes, leukocytes, spleen, thymus and tonsil), while isoform 2 is detected only in lymph nodes, leukocytes and spleen. Expressed on activated monocytes and dendritic cells.
- O75144 ICOSL_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
PTMs - O75144 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T56 | Phosphorylation | Uniprot | |
N70 | N-Glycosylation | Uniprot | |
N186 | N-Glycosylation | Uniprot | |
S285 | Phosphorylation | Uniprot | |
S293 | Phosphorylation | Uniprot |
Research Backgrounds
Ligand for the T-cell-specific cell surface receptor ICOS. Acts as a costimulatory signal for T-cell proliferation and cytokine secretion; induces also B-cell proliferation and differentiation into plasma cells. Could play an important role in mediating local tissue responses to inflammatory conditions, as well as in modulating the secondary immune response by co-stimulating memory T-cell function (By similarity).
Cell membrane>Single-pass type I membrane protein.
Isoform 1 is widely expressed (brain, heart, kidney, liver, lung, pancreas, placenta, skeletal muscle, bone marrow, colon, ovary, prostate, testis, lymph nodes, leukocytes, spleen, thymus and tonsil), while isoform 2 is detected only in lymph nodes, leukocytes and spleen. Expressed on activated monocytes and dendritic cells.
Interacts with CTLA4 (in vitro).
Belongs to the immunoglobulin superfamily. BTN/MOG family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cell adhesion molecules (CAMs). (View pathway)
· Organismal Systems > Immune system > Intestinal immune network for IgA production. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.