FABP3 Antibody - #DF8411
| Product: | FABP3 Antibody |
| Catalog: | DF8411 |
| Description: | Rabbit polyclonal antibody to FABP3 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Chicken |
| Mol.Wt.: | 15 kDa; 15kD(Calculated). |
| Uniprot: | P05413 |
| RRID: | AB_2841662 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8411, RRID:AB_2841662.
Fold/Unfold
422 protein; Cardiac Fatty Acid Binding Protein; FABP 11; FABP 3; FABP11; FABP3; FABPH_HUMAN; Fatty acid binding protein 11; Fatty acid binding protein 3; Fatty acid binding protein 3 muscle and heart; Fatty acid binding protein 3 muscle and heart mammary derived growth inhibitor; Fatty acid binding protein 3 muscle; Fatty acid binding protein 3, muscle and heart (mammary derived growth inhibitor); Fatty acid binding protein 3, muscle; Fatty acid binding protein heart; Fatty acid binding protein, heart; Fatty acid binding protein, muscle and heart; Fatty acid binding protein, skeletal muscle; Fatty acid-binding protein 3; Fatty acid-binding protein; H FABP; H-FABP; heart; Heart type fatty acid binding protein; Heart-type fatty acid-binding protein; M FABP; M-FABP; Mammary derived growth inhibitor; Mammary-derived growth inhibitor; MDGI; Muscle fatty acid binding protein; Muscle fatty acid-binding protein; Mylein protein P2 homolog; O FABP; OTTHUMP00000003898; P2 adopocyte protein;
Immunogens
- P05413 FABPH_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P05413 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| V2 | Acetylation | Uniprot | |
| T8 | Phosphorylation | Uniprot | |
| Y20 | Phosphorylation | Uniprot | |
| S23 | Phosphorylation | Uniprot | |
| T41 | Phosphorylation | Uniprot | |
| T61 | Phosphorylation | Uniprot | |
| T117 | Phosphorylation | Uniprot |
Research Backgrounds
FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.
Cytoplasm.
Forms a beta-barrel structure that accommodates the hydrophobic ligand in its interior.
Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Research Fields
· Organismal Systems > Endocrine system > PPAR signaling pathway.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.