ALOX5AP Antibody - #DF8367
| Product: | ALOX5AP Antibody |
| Catalog: | DF8367 |
| Description: | Rabbit polyclonal antibody to ALOX5AP |
| Application: | WB |
| Reactivity: | Human, Rat |
| Prediction: | Pig, Bovine, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 18 kDa(Observed); 18kD(Calculated). |
| Uniprot: | P20292 |
| RRID: | AB_2841631 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8367, RRID:AB_2841631.
Fold/Unfold
5-lipoxygenase activating protein; AL5AP_HUMAN; ALOX 5AP; ALOX5 AP; ALOX5AP; Arachidonate 5 lipoxygenase activating protein; Arachidonate 5-lipoxygenase-activating protein; Five lipoxygenase activating protein; FLAP; MK 886 binding protein; MK-886-binding protein;
Immunogens
A synthesized peptide derived from human ALOX5AP, corresponding to a region within the internal amino acids.
- P20292 AL5AP_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Required for leukotriene biosynthesis by ALOX5 (5-lipoxygenase). Anchors ALOX5 to the membrane. Binds arachidonic acid, and could play an essential role in the transfer of arachidonic acid to ALOX5. Binds to MK-886, a compound that blocks the biosynthesis of leukotrienes.
Nucleus membrane>Multi-pass membrane protein. Endoplasmic reticulum membrane>Multi-pass membrane protein.
The C-terminal part after residue 140 is mostly unstructured.
Belongs to the MAPEG family.
Research Fields
· Organismal Systems > Immune system > Fc epsilon RI signaling pathway. (View pathway)
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.