ATG10 Antibody - #DF8366

Product: | ATG10 Antibody |
Catalog: | DF8366 |
Description: | Rabbit polyclonal antibody to ATG10 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Sheep, Rabbit, Chicken |
Mol.Wt.: | 25 kDa; 25kD(Calculated). |
Uniprot: | Q9H0Y0 |
RRID: | AB_2841630 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8366, RRID:AB_2841630.
Fold/Unfold
Apg 10; APG 10L; APG10; APG10 autophagy 10 like; APG10 like; APG10, S. cerevisiae, homolog of; APG10-like; APG10L; ATG 10; ATG10; ATG10 autophagy related 10 homolog (S. cerevisiae); ATG10 autophagy related 10 homolog; ATG10_HUMAN; autophagy 10, S. cerevisiae, homolog of; Autophagy related protein 10; Autophagy-related protein 10; DKFZP586I0418; FLJ13954; pp12616; Ubiquitin-like-conjugating enzyme ATG10;
Immunogens
- Q9H0Y0 ATG10_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEEDEFIGEKTFQRYCAEFIKHSQQIGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKMRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9H0Y0 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K10 | Ubiquitination | Uniprot |
Research Backgrounds
E2-like enzyme involved in autophagy. Acts as an E2-like enzyme that catalyzes the conjugation of ATG12 to ATG5. ATG12 conjugation to ATG5 is required for autophagy. Likely serves as an ATG5-recognition molecule. Not involved in ATG12 conjugation to ATG3 (By similarity). Plays a role in adenovirus-mediated cell lysis.
Cytoplasm.
Interacts with MAP1LC3A. By interacting with MAP1LC3A, it plays a role in the conjugation of ATG12 to ATG5. Also able to directly interact either with ATG5 or ATG7 (By similarity). Interacts with IRGM.
Belongs to the ATG10 family.
Research Fields
· Cellular Processes > Transport and catabolism > Autophagy - other. (View pathway)
· Cellular Processes > Transport and catabolism > Autophagy - animal. (View pathway)
References
Application: WB Species: human Sample: SW480-OxR cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.