PCYOX1 Antibody - #DF8332
| Product: | PCYOX1 Antibody |
| Catalog: | DF8332 |
| Description: | Rabbit polyclonal antibody to PCYOX1 |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 57 kDa; 57kD(Calculated). |
| Uniprot: | Q9UHG3 |
| RRID: | AB_2841603 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8332, RRID:AB_2841603.
Fold/Unfold
EC 1.8.3.5; KIAA0908; PCL1; PCYOX_HUMAN; PCYOX1; Prenylcysteine lyase; Prenylcysteine oxidase 1; Prenylcysteine oxidase precursor;
Immunogens
- Q9UHG3 PCYOX_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGRVVAELVSSLLGLWLLLCSCGCPEGAELRAPPDKIAIIGAGIGGTSAAYYLRQKFGKDVKIDLFEREEVGGRLATMMVQGQEYEAGGSVIHPLNLHMKRFVKDLGLSAVQASGGLLGIYNGETLVFEESNWFIINVIKLVWRYGFQSLRMHMWVEDVLDKFMRIYRYQSHDYAFSSVEKLLHALGGDDFLGMLNRTLLETLQKAGFSEKFLNEMIAPVMRVNYGQSTDINAFVGAVSLSCSDSGLWAVEGGNKLVCSGLLQASKSNLISGSVMYIEEKTKTKYTGNPTKMYEVVYQIGTETRSDFYDIVLVATPLNRKMSNITFLNFDPPIEEFHQYYQHIVTTLVKGELNTSIFSSRPIDKFGLNTVLTTDNSDLFINSIGIVPSVREKEDPEPSTDGTYVWKIFSQETLTKAQILKLFLSYDYAVKKPWLAYPHYKPPEKCPSIILHDRLYYLNGIECAASAMEMSAIAAHNAALLAYHRWNGHTDMIDQDGLYEKLKTEL
PTMs - Q9UHG3 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T47 | Phosphorylation | Uniprot | |
| Y51 | Phosphorylation | Uniprot | |
| K62 | Ubiquitination | Uniprot | |
| K162 | Ubiquitination | Uniprot | |
| S171 | Phosphorylation | Uniprot | |
| Y174 | Phosphorylation | Uniprot | |
| S177 | Phosphorylation | Uniprot | |
| N196 | N-Glycosylation | Uniprot | |
| T202 | Phosphorylation | Uniprot | |
| K205 | Ubiquitination | Uniprot | |
| C258 | S-Nitrosylation | Uniprot | |
| Y308 | Phosphorylation | Uniprot | |
| N323 | N-Glycosylation | Uniprot | |
| Y339 | Phosphorylation | Uniprot | |
| N353 | N-Glycosylation | Uniprot | |
| K392 | Ubiquitination | Uniprot | |
| Y403 | Phosphorylation | Uniprot | |
| K415 | Acetylation | Uniprot | |
| K415 | Ubiquitination | Uniprot | |
| Y425 | Phosphorylation | Uniprot | |
| Y427 | Phosphorylation | Uniprot | |
| Y482 | Phosphorylation | Uniprot | |
| Y498 | Phosphorylation | Uniprot |
Research Backgrounds
Involved in the degradation of prenylated proteins. Cleaves the thioether bond of prenyl-L-cysteines, such as farnesylcysteine and geranylgeranylcysteine.
The protein is glycosylated at one or more potential N-glycosylation sites.
Lysosome.
Ubiquitous.
Belongs to the prenylcysteine oxidase family.
Research Fields
· Metabolism > Metabolism of terpenoids and polyketides > Terpenoid backbone biosynthesis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.