LEFTY2 Antibody - #DF8330
| Product: | LEFTY2 Antibody |
| Catalog: | DF8330 |
| Description: | Rabbit polyclonal antibody to LEFTY2 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Sheep |
| Mol.Wt.: | 41 kDa; 41kD(Calculated). |
| Uniprot: | O00292 |
| RRID: | AB_2841602 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8330, RRID:AB_2841602.
Fold/Unfold
EBAF; Endometrial bleeding associated factor (left right determination factor A transforming growth factor beta superfamily); Endometrial bleeding associated factor; Endometrial bleeding-associated factor; Left right determination factor 2; Left right determination factor A; Left-right determination factor 2; Left-right determination factor A; LEFTA; LEFTY 2; LEFTY2; LEFTYA; LFTY2 transforming growth factor, beta -4; LFTY2, mouse, homolog of; LFTY2_HUMAN; MGC46222; Protein lefty 2; Protein lefty A; Protein lefty-2; Protein lefty-A; Protein lefty2; PSEC0024; TGF beta 4; TGF-beta-4; TGFB4; Transforming growth factor beta 4; Transforming growth factor beta-4;
Immunogens
A synthesized peptide derived from human LEFTY2, corresponding to a region within the internal amino acids.
- O00292 LFTY2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQYVVLLRRSHGDRSRGKRFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Required for left-right (L-R) asymmetry determination of organ systems in mammals. May play a role in endometrial bleeding.
The processing of the protein may also occur at the second R-X-X-R site located at AA 132-135. Processing appears to be regulated in a cell-type specific manner.
Secreted.
Mesenchymal cells of the endometrial stroma.
Belongs to the TGF-beta family.
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Signaling pathways regulating pluripotency of stem cells. (View pathway)
· Environmental Information Processing > Signal transduction > TGF-beta signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.