RCC1 Antibody - #DF8275
Product: | RCC1 Antibody |
Catalog: | DF8275 |
Description: | Rabbit polyclonal antibody to RCC1 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 45 kDa; 45kD(Calculated). |
Uniprot: | P18754 |
RRID: | AB_2841564 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8275, RRID:AB_2841564.
Fold/Unfold
Cell cycle regulatory protein; CHC 1; CHC1; Chromosome condensation 1; Chromosome condensation protein 1; Guanine nucleotide releasing protein; HERC2; Ran GEF; RanGEF; RCC 1; RCC1; RCC1 I; RCC1_HUMAN; Regulator of chromosome condensation 1; Regulator of chromosome condensation; SHEP1; SNHG3 RCC1; SNHG3 RCC1 readthrough transcript;
Immunogens
- P18754 RCC1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P18754 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S2 | Methylation | Uniprot | |
S2 | Phosphorylation | Q13188 (STK3) , P06493 (CDK1) | Uniprot |
S11 | Phosphorylation | P06493 (CDK1) , Q13188 (STK3) | Uniprot |
S20 | Phosphorylation | Uniprot | |
S26 | Phosphorylation | Uniprot | |
S29 | Phosphorylation | Uniprot | |
T32 | Phosphorylation | Uniprot | |
S85 | Phosphorylation | Uniprot | |
Y89 | Phosphorylation | Uniprot | |
S90 | Phosphorylation | Uniprot | |
C93 | S-Nitrosylation | Uniprot | |
S104 | Phosphorylation | Uniprot | |
K114 | Sumoylation | Uniprot | |
K114 | Ubiquitination | Uniprot | |
K120 | Ubiquitination | Uniprot | |
T131 | Phosphorylation | Uniprot | |
T135 | Phosphorylation | Uniprot | |
K160 | Ubiquitination | Uniprot | |
K161 | Ubiquitination | Uniprot | |
S162 | Phosphorylation | Uniprot | |
R214 | Methylation | Uniprot | |
K227 | Ubiquitination | Uniprot | |
K232 | Ubiquitination | Uniprot | |
T274 | Phosphorylation | P06493 (CDK1) | Uniprot |
T306 | Phosphorylation | Uniprot | |
S311 | Phosphorylation | Uniprot | |
K335 | Sumoylation | Uniprot | |
K335 | Ubiquitination | Uniprot | |
S336 | Phosphorylation | Uniprot | |
T339 | Phosphorylation | Uniprot | |
K362 | Ubiquitination | Uniprot | |
S387 | Phosphorylation | P06493 (CDK1) | Uniprot |
S403 | Phosphorylation | Uniprot | |
S405 | Phosphorylation | Uniprot | |
S406 | Phosphorylation | Uniprot | |
T411 | Phosphorylation | Uniprot |
Research Backgrounds
Guanine-nucleotide releasing factor that promotes the exchange of Ran-bound GDP by GTP, and thereby plays an important role in RAN-mediated functions in nuclear import and mitosis. Contributes to the generation of high levels of chromosome-associated, GTP-bound RAN, which is important for mitotic spindle assembly and normal progress through mitosis. Via its role in maintaining high levels of GTP-bound RAN in the nucleus, contributes to the release of cargo proteins from importins after nuclear import. Involved in the regulation of onset of chromosome condensation in the S phase. Binds both to the nucleosomes and double-stranded DNA.
N-terminal methylation by METTL11A/NTM1 is required for binding double-stranded DNA and stable chromatin association. Di- and trimethylation produce a permanent positive charge on the amino group, which facilitates electrostatic binding to the phosphate groups on DNA, while inhibiting histone-binding. Methylated tail helps retain RCC1 on chromosomes during nucleotide exchange on Ran.
Nucleus. Chromosome. Cytoplasm.
Note: Predominantly nuclear in interphase cells (PubMed:12194828). Binds to mitotic chromosomes (PubMed:12194828, PubMed:17435751, PubMed:20668449).
Interacts with RAN. Interacts (via N-terminus and RCC1 repeats) with KPNA4. Interacts with ARRB2; the interaction is detected in the nucleus upon OR1D2 stimulation.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.