PNP Antibody - #DF8260

Product: | PNP Antibody |
Catalog: | DF8260 |
Description: | Rabbit polyclonal antibody to PNP |
Application: | WB IHC IF/ICC |
Reactivity: | Human |
Prediction: | Pig, Dog |
Mol.Wt.: | 32 kDa; 32kD(Calculated). |
Uniprot: | P00491 |
RRID: | AB_2841550 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8260, RRID:AB_2841550.
Fold/Unfold
FLJ94043; FLJ97288; FLJ97312; Inosine phosphorylase; Inosine-guanosine phosphorylase; MGC117396; MGC125915; MGC125916; NP; Np1; Nucleoside phosphorylase; PNP; Pnp1; PNPH_HUMAN; PRO1837; PUNP; Purine nucleoside orthophosphate ribosyltransferase; Purine nucleoside phosphorylase 5a; Purine nucleoside phosphorylase;
Immunogens
Expressed in red blood cells; overexpressed in red blood cells (cytoplasm) of patients with hereditary non-spherocytic hemolytic anemia of unknown etiology.
- P00491 PNPH_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P00491 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
K11 | Ubiquitination | Uniprot | |
S19 | Phosphorylation | Uniprot | |
K22 | Ubiquitination | Uniprot | |
S33 | Phosphorylation | Uniprot | |
T39 | Phosphorylation | Uniprot | |
K95 | Acetylation | Uniprot | |
K95 | Ubiquitination | Uniprot | |
R168 | Methylation | Uniprot | |
T169 | Phosphorylation | Uniprot | |
S176 | Phosphorylation | Uniprot | |
T177 | Phosphorylation | Uniprot | |
K179 | Ubiquitination | Uniprot | |
K211 | Acetylation | Uniprot | |
K211 | Ubiquitination | Uniprot | |
T242 | Phosphorylation | Uniprot | |
Y249 | Phosphorylation | Uniprot | |
S251 | Phosphorylation | Uniprot | |
K254 | Acetylation | Uniprot | |
K254 | Ubiquitination | Uniprot | |
K265 | Ubiquitination | Uniprot | |
K287 | Ubiquitination | Uniprot | |
S289 | Phosphorylation | Uniprot |
Research Backgrounds
The purine nucleoside phosphorylases catalyze the phosphorolytic breakdown of the N-glycosidic bond in the beta-(deoxy)ribonucleoside molecules, with the formation of the corresponding free purine bases and pentose-1-phosphate.
Cytoplasm>Cytoskeleton. Cytoplasm.
Expressed in red blood cells; overexpressed in red blood cells (cytoplasm) of patients with hereditary non-spherocytic hemolytic anemia of unknown etiology.
Homotrimer.
Belongs to the PNP/MTAP phosphorylase family.
Research Fields
· Metabolism > Nucleotide metabolism > Purine metabolism.
· Metabolism > Nucleotide metabolism > Pyrimidine metabolism.
· Metabolism > Metabolism of cofactors and vitamins > Nicotinate and nicotinamide metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
References
Application: WB Species: Mouse Sample:
Application: IHC Species: Mouse Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.