Product: PNP Antibody
Catalog: DF8260
Description: Rabbit polyclonal antibody to PNP
Application: WB IHC IF/ICC
Cited expt.: WB, IHC
Reactivity: Human, Rat
Prediction: Pig, Dog
Mol.Wt.: 32 kDa(Observed); 32kD(Calculated).
Uniprot: P00491
RRID: AB_2841550

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Rat
Prediction:
Pig(88%), Dog(88%)
Clonality:
Polyclonal
Specificity:
PNP Antibody detects endogenous levels of total PNP.
RRID:
AB_2841550
Cite Format: Affinity Biosciences Cat# DF8260, RRID:AB_2841550.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

FLJ94043; FLJ97288; FLJ97312; Inosine phosphorylase; Inosine-guanosine phosphorylase; MGC117396; MGC125915; MGC125916; NP; Np1; Nucleoside phosphorylase; PNP; Pnp1; PNPH_HUMAN; PRO1837; PUNP; Purine nucleoside orthophosphate ribosyltransferase; Purine nucleoside phosphorylase 5a; Purine nucleoside phosphorylase;

Immunogens

Immunogen:

A synthesized peptide derived from human PNP, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P00491 PNPH_HUMAN:

Expressed in red blood cells; overexpressed in red blood cells (cytoplasm) of patients with hereditary non-spherocytic hemolytic anemia of unknown etiology.

Sequence:
MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
88
Dog
88
Bovine
75
Rabbit
75
Horse
0
Sheep
0
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

The purine nucleoside phosphorylases catalyze the phosphorolytic breakdown of the N-glycosidic bond in the beta-(deoxy)ribonucleoside molecules, with the formation of the corresponding free purine bases and pentose-1-phosphate.

Subcellular Location:

Cytoplasm>Cytoskeleton. Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in red blood cells; overexpressed in red blood cells (cytoplasm) of patients with hereditary non-spherocytic hemolytic anemia of unknown etiology.

Family&Domains:

Belongs to the PNP/MTAP phosphorylase family.

Research Fields

· Metabolism > Nucleotide metabolism > Purine metabolism.

· Metabolism > Nucleotide metabolism > Pyrimidine metabolism.

· Metabolism > Metabolism of cofactors and vitamins > Nicotinate and nicotinamide metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

References

1). Inosine enhances tumor mitochondrial respiration by inducing Rag GTPases and nascent protein synthesis under nutrient starvation. Cell death & disease, 2023 (PubMed: 37532694) [IF=8.1]

Application: WB    Species: Mouse    Sample:

Fig. 1. Elevation of inosine level promotes BC survival under glucose starvation. A MDA-MB-231 tumor tissues from the core and margin regions were separated to subject to RNA-seq and GSEA analysis, showing enrichment of genes related to the indicated pathway (n = 3 mice per group). B Representative mass spectrometry imaging for Inosine-5′-monophosphate abundance in MDA-MB-231 and 4T1 wild-type tumors from NSG mice and Balb/C mice. Scale bar, 2 mm. C Tissues from core and margin regions of 4T1 xenografted tumors were used for inosine detection. Inosine concentrations were measured by ELISA kit (paired two-tailed Student’s t-test, n = 7 mice per group). D Schematic diagram depicting inosine metabolic pathway. E The level of genes in purine pathway gene sets in the core and margin regions of MDA-MB-231 xenografted tumors are shown as a heat map. F Relative Nt5c2, Pnp, and Ada1 RNA levels in core and margin regions of 4T1 cells xenografted tumors determined by RT-qPCR (paired two-tailed Student’s t-test, n = 4 mice per group). G 4T1 tumor tissues were harvested from Balb/C mice. Tissues from the core and margin regions were separated to collect whole cell lysates, followed by western blots analysis. Indicated protein levels were assessed by western blots. H Representative IHC images showing indicated protein staining of core and margin regions tissues separated from 4T1 tumors. Scale bar, 50 μm. I Tumor volume followed in indicated xenografted mice (two-way ANOVA, n = 4 mice per group). J Representative tumor images of indicated xenografted tumors in Balb/C mice were shown (n = 8 mice per group). K Tumor weight was monitored at the end of the experiment in indicated xenografted mice (unpaired two-tailed Student’s t-test, n = 8 mice per group). L Tissues of 4T1 and 4T1/NT5C2 KD cells xenografted tumors were used for inosine detection. Inosine concentrations were measured by ELISA kit (paired two-tailed Student’s t-test, n = 6 mice per group). M Representative IHC images showing Ki67 staining of core regions tissues separated from 4T1 and 4T1/NT5C2 KD tumors. Scale bar, 50 μm. N MDA-MB-231 labeled Lck-GFP (231/Lck-GFP) cells were treated with glucose–glutamine-deficient medium (-G-Q) or supplemented with inosine or glucose. The fluorescent images were taken at the indicated time. Scale bar, 500 μm. O Quantification of the fold change of the cell numbers for (N) (one-way ANOVA, n = 3 biological replicates).

Application: IHC    Species: Mouse    Sample:

Fig. 1. Elevation of inosine level promotes BC survival under glucose starvation. A MDA-MB-231 tumor tissues from the core and margin regions were separated to subject to RNA-seq and GSEA analysis, showing enrichment of genes related to the indicated pathway (n = 3 mice per group). B Representative mass spectrometry imaging for Inosine-5′-monophosphate abundance in MDA-MB-231 and 4T1 wild-type tumors from NSG mice and Balb/C mice. Scale bar, 2 mm. C Tissues from core and margin regions of 4T1 xenografted tumors were used for inosine detection. Inosine concentrations were measured by ELISA kit (paired two-tailed Student’s t-test, n = 7 mice per group). D Schematic diagram depicting inosine metabolic pathway. E The level of genes in purine pathway gene sets in the core and margin regions of MDA-MB-231 xenografted tumors are shown as a heat map. F Relative Nt5c2, Pnp, and Ada1 RNA levels in core and margin regions of 4T1 cells xenografted tumors determined by RT-qPCR (paired two-tailed Student’s t-test, n = 4 mice per group). G 4T1 tumor tissues were harvested from Balb/C mice. Tissues from the core and margin regions were separated to collect whole cell lysates, followed by western blots analysis. Indicated protein levels were assessed by western blots. H Representative IHC images showing indicated protein staining of core and margin regions tissues separated from 4T1 tumors. Scale bar, 50 μm. I Tumor volume followed in indicated xenografted mice (two-way ANOVA, n = 4 mice per group). J Representative tumor images of indicated xenografted tumors in Balb/C mice were shown (n = 8 mice per group). K Tumor weight was monitored at the end of the experiment in indicated xenografted mice (unpaired two-tailed Student’s t-test, n = 8 mice per group). L Tissues of 4T1 and 4T1/NT5C2 KD cells xenografted tumors were used for inosine detection. Inosine concentrations were measured by ELISA kit (paired two-tailed Student’s t-test, n = 6 mice per group). M Representative IHC images showing Ki67 staining of core regions tissues separated from 4T1 and 4T1/NT5C2 KD tumors. Scale bar, 50 μm. N MDA-MB-231 labeled Lck-GFP (231/Lck-GFP) cells were treated with glucose–glutamine-deficient medium (-G-Q) or supplemented with inosine or glucose. The fluorescent images were taken at the indicated time. Scale bar, 500 μm. O Quantification of the fold change of the cell numbers for (N) (one-way ANOVA, n = 3 biological replicates).

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.