CTSS Antibody - #DF8246
Product: | CTSS Antibody |
Catalog: | DF8246 |
Description: | Rabbit polyclonal antibody to CTSS |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 37 kDa; 37kD(Calculated). |
Uniprot: | P25774 |
RRID: | AB_2841541 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8246, RRID:AB_2841541.
Fold/Unfold
Cathepsin S; CathepsinS; CATS_HUMAN; Ctss;
Immunogens
- P25774 CATS_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P25774 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K42 | Ubiquitination | Uniprot | |
S171 | Phosphorylation | Uniprot | |
Y175 | Phosphorylation | Uniprot | |
S200 | Phosphorylation | Uniprot | |
Y215 | Phosphorylation | Uniprot | |
S217 | Phosphorylation | Uniprot | |
Y232 | Phosphorylation | Uniprot | |
Y262 | Phosphorylation | Uniprot |
Research Backgrounds
Thiol protease. Key protease responsible for the removal of the invariant chain from MHC class II molecules. The bond-specificity of this proteinase is in part similar to the specificities of cathepsin L.
Lysosome. Secreted.
Monomer.
Belongs to the peptidase C1 family.
Research Fields
· Cellular Processes > Transport and catabolism > Lysosome. (View pathway)
· Cellular Processes > Transport and catabolism > Phagosome. (View pathway)
· Cellular Processes > Cell growth and death > Apoptosis. (View pathway)
· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.
· Organismal Systems > Immune system > Antigen processing and presentation. (View pathway)
References
Application: WB Species: Mouse Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.