TAF9B Antibody - #DF8206
Product: | TAF9B Antibody |
Catalog: | DF8206 |
Description: | Rabbit polyclonal antibody to TAF9B |
Application: | WB |
Reactivity: | Human, Mouse |
Prediction: | Bovine, Horse, Sheep, Dog |
Mol.Wt.: | 28 kDa; 28kD(Calculated). |
Uniprot: | Q9HBM6 |
RRID: | AB_2841514 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8206, RRID:AB_2841514.
Fold/Unfold
DN-7; DN7; Neuronal cell death related protein 7; Neuronal cell death-related protein 7; TAF9-like RNA polymerase II TBP associated factor, 31 kD; Taf9b; TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa; TAF9B_HUMAN; TAF9L; TAFII31L; TFIID-31; Transcription initiation factor TFIID subunit 9-like; Transcription initiation factor TFIID subunit 9-like protein; Transcription initiation factor TFIID subunit 9B; Transcription-associated factor TAFII31L;
Immunogens
- Q9HBM6 TAF9B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MESGKMAPPKNAPRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKPNVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLIKKGPNQGRLVPRLSVGAVSSKPTTPTIATPQTVSVPNKVATPMSVTSQRFTVQIPPSQSTPVKPVPATTAVQNVLINPSMIGPKNILITTNMVSSQNTANEANPLKRKHEDDDDNDIM
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9HBM6 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
S3 | Phosphorylation | Uniprot | |
K5 | Ubiquitination | Uniprot | |
K10 | Ubiquitination | Uniprot | |
K24 | Ubiquitination | Uniprot | |
Y46 | Phosphorylation | Uniprot | |
K55 | Ubiquitination | Uniprot | |
Y57 | Phosphorylation | Uniprot | |
K62 | Ubiquitination | Uniprot | |
S82 | Phosphorylation | Uniprot | |
S85 | Phosphorylation | Uniprot | |
K99 | Ubiquitination | Uniprot | |
T102 | Phosphorylation | Uniprot | |
K108 | Acetylation | Uniprot | |
K108 | Ubiquitination | Uniprot | |
R119 | Methylation | Uniprot | |
R128 | Methylation | Uniprot | |
S147 | Phosphorylation | Uniprot | |
S152 | Phosphorylation | Uniprot | |
S153 | Phosphorylation | Uniprot | |
T156 | Phosphorylation | Uniprot | |
T157 | Phosphorylation | Uniprot | |
T159 | Phosphorylation | Uniprot | |
T162 | Phosphorylation | Uniprot | |
T174 | Phosphorylation | Uniprot | |
S177 | Phosphorylation | Uniprot | |
S190 | Phosphorylation | Uniprot | |
S192 | Phosphorylation | Uniprot | |
T193 | Phosphorylation | Uniprot |
Research Backgrounds
Essential for cell viability. TAF9 and TAF9B are involved in transcriptional activation as well as repression of distinct but overlapping sets of genes. May have a role in gene regulation associated with apoptosis. TAFs are components of the transcription factor IID (TFIID) complex, the TBP-free TAFII complex (TFTC), the PCAF histone acetylase complex and the STAGA transcription coactivator-HAT complex. TFIID or TFTC are essential for the regulation of RNA polymerase II-mediated transcription.
Nucleus.
Binds TAF5 and TAF6. Component of TFIID and the TATA-binding protein-free TAF complex (TFTC). TFIID is composed of TATA binding protein (TBP) and a number of TBP-associated factors (TAFs). Binds N-terminal domain of p53/TP53 which is essential for transcription.
Belongs to the TAF9 family.
Research Fields
· Genetic Information Processing > Transcription > Basal transcription factors.
· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.