CHRNA4 Antibody - #DF8199
Product: | CHRNA4 Antibody |
Catalog: | DF8199 |
Description: | Rabbit polyclonal antibody to CHRNA4 |
Application: | WB |
Reactivity: | Human |
Prediction: | Pig, Bovine, Dog, Chicken |
Mol.Wt.: | 70 kDa; 70kD(Calculated). |
Uniprot: | P43681 |
RRID: | AB_2841507 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8199, RRID:AB_2841507.
Fold/Unfold
A4 nicotinic receptor; Acetylcholine receptor alpha 4 neural; Acetylcholine receptor neuronal nicotinic alpha 4 subunit; ACH 4; ACH4; ACHA4_HUMAN; AChR; Acra 4; Acra4; Alpha4 nAChR; BFNC; Cholinergic receptor nicotinic alpha 4; Cholinergic receptor nicotinic alpha polypeptide 4; CHRNA 4; CHRNA4; EBN 1; EBN; EBN1; NACHR; NACRA 4; NACRA4; Neuronal acetylcholine receptor subunit alpha-4; Neuronal nicotinic acetylcholine receptor alpha 4 subunit;
Immunogens
- P43681 ACHA4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MELGGPGAPRLLPPLLLLLGTGLLRASSHVETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVNMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPTWVRRVFLDIVPRLLLMKRPSVVKDNCRRLIESMHKMASAPRFWPEPEGEPPATSGTQSLHPPSPSFCVPLDVPAEPGPSCKSPSDQLPPQQPLEAEKASPHPSPGPCRPPHGTQAPGLAKARSLSVQHMSSPGEAVEGGVRCRSRSIQYCVPRDDAAPEADGQAAGALASRNTHSAELPPPDQPSPCKCTCKKEPSSVSPSATVKTRSTKAPPPHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTVGLFLPPWLAGMI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P43681 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
R10 | Methylation | Uniprot | |
R25 | Methylation | Uniprot | |
R33 | Methylation | Uniprot | |
S196 | Phosphorylation | Uniprot | |
S362 | Phosphorylation | Uniprot | |
S467 | Phosphorylation | Uniprot | |
S488 | Phosphorylation | Uniprot | |
S538 | Phosphorylation | Uniprot | |
S539 | Phosphorylation | Uniprot | |
S543 | Phosphorylation | Uniprot | |
T545 | Phosphorylation | Uniprot | |
S550 | Phosphorylation | Uniprot | |
S561 | Phosphorylation | Uniprot |
Research Backgrounds
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane permeable to sodium ions.
Cell junction>Synapse>Postsynaptic cell membrane>Multi-pass membrane protein. Cell membrane>Multi-pass membrane protein. Cell membrane>Lipid-anchor.
Neuronal AChR is composed of two different types of subunits: alpha and beta. Alpha-4 subunit can be combined to beta-2 or beta-4 to give rise to functional receptors, complexes with beta-2 may be heteropentamers. Interacts with RIC3; which is required for proper folding and assembly. Interacts with LYPD6. The heteropentamer alpha-4-beta-2 interacts with alpha-conotoxins PnIA, GID and MII (By similarity).
Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha-4/CHRNA4 sub-subfamily.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.
· Organismal Systems > Nervous system > Cholinergic synapse.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.