Product: SENP3 Antibody
Catalog: DF8198
Description: Rabbit polyclonal antibody to SENP3
Application: WB
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 65 kDa, 80 kDa; 65kD(Calculated).
Uniprot: Q9H4L4
RRID: AB_2841506

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(92%), Horse(91%), Sheep(92%), Rabbit(92%), Dog(83%)
Clonality:
Polyclonal
Specificity:
SENP3 Antibody detects endogenous levels of total SENP3.
RRID:
AB_2841506
Cite Format: Affinity Biosciences Cat# DF8198, RRID:AB_2841506.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

SENP3; SENP3_HUMAN; Sentrin / SUMO specific protease 3; Sentrin specific protease 3; Sentrin-specific protease 3; Sentrin/SUMO-specific protease SENP3; SMT3IP1; SSP3; SUMO 1 specific protease 3; SUMO-1-specific protease 3; SUMO1 specific protease 3; SUMO1/sentrin/SMT3 specific peptidase 3; SUSP3;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Sequence:
MKETIQGTGSWGPEPPGPGIPPAYSSPRRERLRWPPPPKPRLKSGGGFGPDPGSGTTVPARRLPVPRPSFDASASEEEEEEEEEEDEDEEEEVAAWRLPPRWSQLGTSQRPRPSRPTHRKTCSQRRRRAMRAFRMLLYSKSTSLTFHWKLWGRHRGRRRGLAHPKNHLSPQQGGATPQVPSPCCRFDSPRGPPPPRLGLLGALMAEDGVRGSPPVPSGPPMEEDGLRWTPKSPLDPDSGLLSCTLPNGFGGQSGPEGERSLAPPDASILISNVCSIGDHVAQELFQGSDLGMAEEAERPGEKAGQHSPLREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTLYGQNWLNDQVMNMYGDLVMDTVPEKVHFFNSFFYDKLRTKGYDGVKRWTKNVDIFNKELLLIPIHLEVHWSLISVDVRRRTITYFDSQRTLNRRCPKHIAKYLQAEAVKKDRLDFHQGWKGYFKMNVARQNNDSDCGAFVLQYCKHLALSQPFSFTQQDMPKLRRQIYKELCHCKLTV

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Bovine
92
Sheep
92
Rabbit
92
Horse
91
Dog
83
Xenopus
50
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - Q9H4L4 As Substrate

Site PTM Type Enzyme
K2 Methylation
Y24 Phosphorylation
S25 Phosphorylation
S26 Phosphorylation
K43 Methylation
K43 Ubiquitination
S44 Phosphorylation
S54 Phosphorylation
S69 Phosphorylation
S73 Phosphorylation
S75 Phosphorylation
K120 Acetylation
S139 Phosphorylation
S141 Phosphorylation
T142 Phosphorylation
S143 Phosphorylation
T145 Phosphorylation
S169 Phosphorylation
T176 Phosphorylation
S181 Phosphorylation
S188 Phosphorylation
R190 Methylation
S212 Phosphorylation
S217 Phosphorylation
T229 Phosphorylation
K231 Ubiquitination
S232 Phosphorylation
S238 Phosphorylation
S242 Phosphorylation
S253 Phosphorylation
S307 Phosphorylation
T353 Phosphorylation
K357 Ubiquitination
K436 Ubiquitination
K442 Ubiquitination
K446 Ubiquitination
T477 Phosphorylation
S483 Phosphorylation
K497 Ubiquitination
Y498 Phosphorylation
K505 Ubiquitination
K516 Ubiquitination
K520 Ubiquitination
K541 Ubiquitination
K558 Ubiquitination
K565 Ubiquitination

Research Backgrounds

Function:

Protease that releases SUMO2 and SUMO3 monomers from sumoylated substrates, but has only weak activity against SUMO1 conjugates. Deconjugates SUMO2 from MEF2D, which increases its transcriptional activation capability. Deconjugates SUMO2 and SUMO3 from CDCA8. Redox sensor that, when redistributed into nucleoplasm, can act as an effector to enhance HIF1A transcriptional activity by desumoylating EP300. Required for rRNA processing through deconjugation of SUMO2 and SUMO3 from nucleophosmin, NPM1. Plays a role in the regulation of sumoylation status of ZNF148. Functions as a component of the Five Friends of Methylated CHTOP (5FMC) complex; the 5FMC complex is recruited to ZNF148 by methylated CHTOP, leading to desumoylation of ZNF148 and subsequent transactivation of ZNF148 target genes.

Subcellular Location:

Nucleus>Nucleolus. Nucleus>Nucleoplasm. Cytoplasm.
Note: Redistributes between the nucleolus and the nucleoplasm in response to mild oxidative stress (PubMed:19680224). Mainly found in the nucleoplasm, with low levels detected in the cytoplasmic and chromatin fractions (By similarity).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Binds to SUMO1 and SUMO3 (By similarity). Component of some MLL1/MLL complex, at least composed of the core components KMT2A/MLL1, ASH2L, HCFC1/HCF1, WDR5 and RBBP5, as well as the facultative components BAP18, CHD8, E2F6, HSP70, INO80C, KANSL1, LAS1L, MAX, MCRS1, MGA, MYST1/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10. Interacts with EP300, NPM1 and CDCA8. Component of the 5FMC complex, at least composed of PELP1, LAS1L, TEX10, WDR18 and SENP3; the complex interacts with methylated CHTOP and ZNF148. Interacts with NOL9. Interacts with CCAR2.

Family&Domains:

Belongs to the peptidase C48 family.

References

1). Porcine circovirus type 2 infection promotes the SUMOylation of nucleophosmin-1 to facilitate the viral circular single-stranded DNA replication. PLoS pathogens, 2024 (PubMed: 38394330) [IF=5.5]

Application: WB    Species: pig    Sample: PK-15 cells

Fig 5. PCV2 infection promotes Ubc9/TRIM24 signalings to enhance the SUMOylation of pNPM1. (A, B) 1 MOI PCV2 or mock (the same volume of medium) infected PK-15 cells for 0 h, 6 h, 12 h, 18 h, and 24 h. (A) The expression levels of SAE1, Ubc9, TRIM24, TRIM62, and SENP3 were analyzed by western blot. (B) The expression levels of Ubc9 and SENP3 relative to β-actin were calculated. (C) The plasmids expressing TRIM24, TRIM62, and pNPM1 were transfected into 293T cells for 48 h, and the interactions of TRIM24 and TRIM62 with pNPM1 were detected by co-IP assays. (D) The plasmids expressing TRIM24, TRIM62, and pNPM1 were transfected into PK-15npm1-/- cells for 24 h, and then the cells were infected with 1 MOI PCV2 or mock for 12 h. The interactions of TRIM24 and TRIM62 with pNPM1 were detected by co-IP assays. (E) The specific siRNAs targeting TRIM24 or TRIM62 were transfected into PK-15 cells for 24 h, then the cells were infected with 1 MOI PCV2 for 12 h. The expression levels of TRIM24, TRIM62, pNPM1, and SUMOylated pNPM1 were detected by western blot and calculated. (F) The specific siRNA targeting Ubc9 was transfected into PK-15 cells for 24 h, then the cells were infected with 1 MOI PCV2 for 12 h. The interactions of TRIM24 with pNPM1 were detected by co-IP assays. **p < 0.01, *p < 0.05 versus the mock-infected cells at the same time point in (B), **p < 0.01 versus the siNC-transfected cells in (E), ##p < 0.01 versus the PCV2-infected cells at 18 h in (B).

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.