ENTPD2 Antibody - #DF8194
Product: | ENTPD2 Antibody |
Catalog: | DF8194 |
Description: | Rabbit polyclonal antibody to ENTPD2 |
Application: | WB |
Reactivity: | Human |
Prediction: | Pig, Bovine, Horse, Sheep, Dog |
Mol.Wt.: | 54 kDa; 54kD(Calculated). |
Uniprot: | Q9Y5L3 |
RRID: | AB_2841503 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8194, RRID:AB_2841503.
Fold/Unfold
NTPDase 2; NTPDase2; CD39 antigen like 1; CD39 antigen-like 1; CD39 like1; CD39L1; CD39like1; ecto ATP diphosphohydrolase 2; ecto ATPase 2; ecto ATPDase 2; Ecto-ATP diphosphohydrolase 2; Ecto-ATPase 2; Ecto-ATPDase 2; ectoATPase 2; ectoATPDase 2; Ectonucleoside triphosphate diphosphohydrolase 2; ENTP2_HUMAN; Entpd2; NTPDase 2;
Immunogens
Brain, placenta, skeletal muscle, kidney, pancreas, heart, ovary, testis, colon, small intestine, prostate and pancreas. No expression in adult thymus, spleen, lung, liver and peripheral blood leukocytes.
- Q9Y5L3 ENTP2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAGKVRSLLPPLLLAAAGLAGLLLLCVPTRDVREPPALKYGIVLDAGSSHTSMFIYKWPADKENDTGIVGQHSSCDVPGGGISSYADNPSGASQSLVGCLEQALQDVPKERHAGTPLYLGATAGMRLLNLTNPEASTSVLMAVTHTLTQYPFDFRGARILSGQEEGVFGWVTANYLLENFIKYGWVGRWFRPRKGTLGAMDLGGASTQITFETTSPAEDRASEVQLHLYGQHYRVYTHSFLCYGRDQVLQRLLASALQTHGFHPCWPRGFSTQVLLGDVYQSPCTMAQRPQNFNSSARVSLSGSSDPHLCRDLVSGLFSFSSCPFSRCSFNGVFQPPVAGNFVAFSAFFYTVDFLRTSMGLPVATLQQLEAAAVNVCNQTWAQLQARVPGQRARLADYCAGAMFVQQLLSRGYGFDERAFGGVIFQKKAADTAVGWALGYMLNLTNLIPADPPGLRKGTDFSSWVVLLLLFASALLAALVLLLRQVHSAKLPSTI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9Y5L3 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T196 | Phosphorylation | Uniprot | |
S215 | Phosphorylation | Uniprot | |
N443 | N-Glycosylation | Uniprot |
Research Backgrounds
In the nervous system, could hydrolyze ATP and other nucleotides to regulate purinergic neurotransmission. Hydrolyzes ADP only to a marginal extent. The order of activity with different substrates is ATP > GTP > CTP = ITP > UTP >> ADP = UDP.
Cell membrane>Multi-pass membrane protein.
Endoplasmic reticulum membrane>Multi-pass membrane protein.
Endoplasmic reticulum membrane>Multi-pass membrane protein.
Brain, placenta, skeletal muscle, kidney, pancreas, heart, ovary, testis, colon, small intestine, prostate and pancreas. No expression in adult thymus, spleen, lung, liver and peripheral blood leukocytes.
Belongs to the GDA1/CD39 NTPase family.
Research Fields
· Metabolism > Nucleotide metabolism > Purine metabolism.
· Organismal Systems > Sensory system > Taste transduction.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.