UBE2N Antibody - #DF8193
| Product: | UBE2N Antibody |
| Catalog: | DF8193 |
| Description: | Rabbit polyclonal antibody to UBE2N |
| Application: | WB |
| Reactivity: | Human |
| Prediction: | Bovine, Sheep, Rabbit, Dog, Xenopus |
| Mol.Wt.: | 17 kDa; 17kD(Calculated). |
| Uniprot: | P61088 |
| RRID: | AB_2841502 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8193, RRID:AB_2841502.
Fold/Unfold
Bendless like ubiquitin conjugating enzyme; Bendless-like ubiquitin-conjugating enzyme; BLU; EC 6.3.2.19; Epididymis secretory protein Li 71; HEL-S-71; Human epidermoid carcinoma mRNA for ubiquitin-conjugating enzyme E2 similar to Drosophila bendless gene product complete cds; MGC131857; MGC8489; UBC 13; Ubc13; UbCH ben; UbcH-ben; UbcH13; UBCHBEN; Ube 2N; Ube2n; UBE2N_HUMAN; Ubiquitin carrier protein N; Ubiquitin conjugating enzyme E2 N; Ubiquitin conjugating enzyme E2N (homologous to yeast UBC13); Ubiquitin conjugating enzyme E2N (UBC13 homolog yeast); Ubiquitin conjugating enzyme E2N; Ubiquitin protein ligase N; Ubiquitin-conjugating enzyme E2 N; Ubiquitin-protein ligase N; Yeast UBC13 homolog;
Immunogens
- P61088 UBE2N_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P61088 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K10 | Acetylation | Uniprot | |
| K10 | Ubiquitination | Uniprot | |
| K24 | Ubiquitination | Uniprot | |
| Y34 | Phosphorylation | Uniprot | |
| S45 | Phosphorylation | Uniprot | |
| K53 | Acetylation | Uniprot | |
| K68 | Ubiquitination | Uniprot | |
| K74 | Ubiquitination | Uniprot | |
| K82 | Acetylation | Uniprot | |
| K82 | Ubiquitination | Uniprot | |
| C87 | S-Nitrosylation | Uniprot | |
| K92 | Acetylation | Uniprot | |
| K92 | Ubiquitination | Uniprot | |
| K94 | Acetylation | Uniprot | |
| K94 | Ubiquitination | Uniprot | |
| T139 | Phosphorylation | Uniprot | |
| R141 | Methylation | Uniprot | |
| T144 | Phosphorylation | Uniprot | |
| R145 | Methylation | Uniprot | |
| Y147 | Phosphorylation | Uniprot |
Research Backgrounds
The UBE2V1-UBE2N and UBE2V2-UBE2N heterodimers catalyze the synthesis of non-canonical 'Lys-63'-linked polyubiquitin chains. This type of polyubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage. Acts together with the E3 ligases, HLTF and SHPRH, in the 'Lys-63'-linked poly-ubiquitination of PCNA upon genotoxic stress, which is required for DNA repair. Appears to act together with E3 ligase RNF5 in the 'Lys-63'-linked polyubiquitination of JKAMP thereby regulating JKAMP function by decreasing its association with components of the proteasome and ERAD. Promotes TRIM5 capsid-specific restriction activity and the UBE2V1-UBE2N heterodimer acts in concert with TRIM5 to generate 'Lys-63'-linked polyubiquitin chains which activate the MAP3K7/TAK1 complex which in turn results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes. Together with RNF135 and UB2V1, catalyzes the viral RNA-dependent 'Lys-63'-linked polyubiquitination of RIG-I/DDX58 to activate the downstream signaling pathway that leads to interferon beta production.
Conjugation to ISG15 impairs formation of the thioester bond with ubiquitin but not interaction with UBE2V2.
Nucleus. Cytoplasm.
Heterodimer with UBE2V2. Interacts (UBE2V2-UBE2N heterodimer) with the E3 ligase STUB1 (via the U-box domain); the complex has a specific 'Lys-63'-linked polyubiquitination activity. Interacts with RNF8 and RNF168. Interacts with RNF11. Interacts with the E3 ligases, HLTF and SHPRH; the interactions promote the 'Lys-63'-linked polyubiquitination of PCNA upon genotoxic stress and lead to DNA repair. Interacts with ARIH2 (via RING-type 2). Interacts with OTUB1; leading to inhibit E2-conjugating activity. Interacts with GPS2; leading to inhibit E2-conjugating activity (By similarity). Interacts with DDX58 and RNF135; involved in DDX58 ubiquitination and activation.
Belongs to the ubiquitin-conjugating enzyme family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > Ubiquitin mediated proteolysis. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.