CD7 Antibody - #DF8157
Product: | CD7 Antibody |
Catalog: | DF8157 |
Description: | Rabbit polyclonal antibody to CD7 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 37 kDa; 25kD(Calculated). |
Uniprot: | P09564 |
RRID: | AB_2841482 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8157, RRID:AB_2841482.
Fold/Unfold
CD7; CD7 antigen (p41); CD7 antigen; CD7 molecule; CD7_HUMAN; GP40; LEU 9; LEU9; p41 protein; T cell antigen CD7; T cell leukemia antigen; T cell surface antigen Leu 9; T-cell antigen CD7; T-cell leukemia antigen; T-cell surface antigen Leu-9; Tp 40; Tp40; TP41;
Immunogens
- P09564 CD7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ
PTMs - P09564 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
N96 | N-Glycosylation | Uniprot | |
K214 | Methylation | Uniprot | |
K214 | Ubiquitination | Uniprot | |
S216 | Phosphorylation | Uniprot | |
Y222 | Phosphorylation | Uniprot | |
S226 | Phosphorylation | Uniprot | |
S228 | Phosphorylation | Uniprot | |
T232 | Phosphorylation | Uniprot | |
S234 | Phosphorylation | Uniprot | |
S235 | Phosphorylation | Uniprot | |
Y239 | Phosphorylation | Uniprot |
Research Backgrounds
Not yet known.
Membrane>Single-pass type I membrane protein.
Interacts with SECTM1.
Research Fields
· Organismal Systems > Immune system > Hematopoietic cell lineage. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.