UBE2L6 Antibody - #DF8152
Product: | UBE2L6 Antibody |
Catalog: | DF8152 |
Description: | Rabbit polyclonal antibody to UBE2L6 |
Application: | WB IF/ICC |
Reactivity: | Human |
Mol.Wt.: | 18 kDa; 18kD(Calculated). |
Uniprot: | O14933 |
RRID: | AB_2841480 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8152, RRID:AB_2841480.
Fold/Unfold
MGC40331; Retinoic acid induced gene B protein; Retinoic acid-induced gene B protein; RIG B; RIG-B; UB2L6_HUMAN; UBCH 8; UbcH8; UBE2L6; Ubiquitin carrier protein; Ubiquitin carrier protein L6; Ubiquitin conjugating enzyme E2L 6; Ubiquitin protein ligase; Ubiquitin protein ligase L6; Ubiquitin-protein ligase L6; Ubiquitin/ISG15 conjugating enzyme E2 L6; Ubiquitin/ISG15-conjugating enzyme E2 L6;
Immunogens
- O14933 UB2L6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS
PTMs - O14933 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K9 | Ubiquitination | Uniprot | |
K17 | Ubiquitination | Uniprot | |
S26 | Phosphorylation | Uniprot | |
K96 | Ubiquitination | Uniprot | |
K138 | Acetylation | Uniprot | |
K138 | Ubiquitination | Uniprot | |
S153 | Phosphorylation | Uniprot |
Research Backgrounds
Catalyzes the covalent attachment of ubiquitin or ISG15 to other proteins. Functions in the E6/E6-AP-induced ubiquitination of p53/TP53. Promotes ubiquitination and subsequent proteasomal degradation of FLT3.
ISGylated.
Present in natural killer cells (at protein level).
Interacts with RNF19A, RNF19B and RNF144B. Interacts with FLT3 (tyrosine phosphorylated).
Belongs to the ubiquitin-conjugating enzyme family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > Ubiquitin mediated proteolysis. (View pathway)
· Human Diseases > Neurodegenerative diseases > Parkinson's disease.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.