SOCS2 Antibody - #DF8133
| Product: | SOCS2 Antibody |
| Catalog: | DF8133 |
| Description: | Rabbit polyclonal antibody to SOCS2 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat, Monkey |
| Prediction: | Pig, Bovine, Sheep, Rabbit, Dog |
| Mol.Wt.: | 23 kDa; 22kD(Calculated). |
| Uniprot: | O14508 |
| RRID: | AB_2841468 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8133, RRID:AB_2841468.
Fold/Unfold
CIS 2; CIS-2; CIS2; Cish 2; Cish2; Cytokine inducible SH2 protein 2; Cytokine-inducible SH2 protein 2; SOCS 2; SOCS-2; Socs2; SOCS2_HUMAN; SSI 2; SSI-2; SSI2; STAT induced STAT inhibitor 2; STAT-induced STAT inhibitor 2; STATI 2; STATI2; Suppressor of cytokine signaling 2;
Immunogens
- O14508 SOCS2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O14508 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| C5 | S-Nitrosylation | Uniprot | |
| S30 | Phosphorylation | Uniprot | |
| K38 | Ubiquitination | Uniprot | |
| C111 | S-Nitrosylation | Uniprot | |
| C167 | S-Nitrosylation | Uniprot |
Research Backgrounds
SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS2 appears to be a negative regulator in the growth hormone/IGF1 signaling pathway. Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
High expression in heart, placenta, lung, kidney and prostate.
Interacts with IGF1 receptor, prolactin receptor and growth hormone (GH) receptor. Associates with the Elongin BC complex.
The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin ligase complexes.
Research Fields
· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway. (View pathway)
· Human Diseases > Endocrine and metabolic diseases > Type II diabetes mellitus.
· Organismal Systems > Endocrine system > Insulin signaling pathway. (View pathway)
· Organismal Systems > Endocrine system > Prolactin signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.