PTS Antibody - #DF8130
| Product: | PTS Antibody |
| Catalog: | DF8130 |
| Description: | Rabbit polyclonal antibody to PTS |
| Application: | WB IF/ICC |
| Reactivity: | Human |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Dog, Chicken |
| Mol.Wt.: | 16 kDa; 16kD(Calculated). |
| Uniprot: | Q03393 |
| RRID: | AB_2841466 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8130, RRID:AB_2841466.
Fold/Unfold
6 pyruvoyl tetrahydrobiopterin synthase; 6 pyruvoyl tetrahydropterin synthase; 6 pyruvoyltetrahydropterin synthase; 6-pyruvoyl tetrahydrobiopterin synthase; EC 4.2.3.12; FLJ97081; OTTHUMP00000235385; PTP synthase; PTPS; PTPS_HUMAN; PTS;
Immunogens
- Q03393 PTPS_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSTEGGGRRCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMVMNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYIWDNLQKVLPVGVLYKVKVYETDNNIVVYKGE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q03393 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S19 | Phosphorylation | Q13976 (PRKG1) , Q13237 (PRKG2) | Uniprot |
| S21 | Phosphorylation | Uniprot | |
| S23 | Phosphorylation | Uniprot | |
| K29 | Ubiquitination | Uniprot | |
| S32 | Phosphorylation | Uniprot | |
| K38 | Ubiquitination | Uniprot | |
| K42 | Ubiquitination | Uniprot | |
| K77 | Ubiquitination | Uniprot | |
| Y128 | Phosphorylation | Uniprot | |
| K129 | Ubiquitination | Uniprot | |
| K131 | Ubiquitination | Uniprot | |
| K143 | Ubiquitination | Uniprot |
Research Backgrounds
Involved in the biosynthesis of tetrahydrobiopterin, an essential cofactor of aromatic amino acid hydroxylases. Catalyzes the transformation of 7,8-dihydroneopterin triphosphate into 6-pyruvoyl tetrahydropterin.
Phosphorylation of Ser-19 is required for maximal enzyme activity.
Homohexamer formed of two homotrimers in a head to head fashion.
Belongs to the PTPS family.
Research Fields
· Metabolism > Metabolism of cofactors and vitamins > Folate biosynthesis.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.