FOXA1 Antibody - #DF8124
| Product: | FOXA1 Antibody |
| Catalog: | DF8124 |
| Description: | Rabbit polyclonal antibody to FOXA1 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human |
| Prediction: | Pig, Zebrafish, Bovine, Sheep, Chicken, Xenopus |
| Mol.Wt.: | 51 kDa; 49kD(Calculated). |
| Uniprot: | P55317 |
| RRID: | AB_2841462 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8124, RRID:AB_2841462.
Fold/Unfold
forkhead box A1; Forkhead box protein A1; FOX A1; FOXA1; FOXA1_HUMAN; hepatocyte nuclear factor 3 alpha; Hepatocyte nuclear factor 3-alpha; HNF 3A; HNF-3-alpha; HNF-3A; HNF3A; MGC33105; TCF 3A; TCF-3A; TCF3A; Transcription factor 3A;
Immunogens
Highly expressed in prostate and ESR1-positive breast tumors. Overexpressed in esophageal and lung adenocarcinomas.
- P55317 FOXA1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMTPASFNMSYANPGLGAGLSPGAVAGMPGGSAGAMNSMTAAGVTAMGTALSPSGMGAMGAQQAASMNGLGPYAAAMNPCMSPMAYAPSNLGRSRAGGGGDAKTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCEKQPGAGGGGGSGSGGSGAKGGPESRKDPSGASNPSADSPLHRGVHGKTGQLEGAPAPGPAASPQTLDHSGATATGGASELKTPASSTAPPISSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P55317 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S165 | Phosphorylation | Uniprot | |
| Y166 | Phosphorylation | Uniprot | |
| S223 | Phosphorylation | Uniprot | |
| S234 | Phosphorylation | Uniprot | |
| K237 | Acetylation | Uniprot | |
| K240 | Acetylation | Uniprot | |
| K264 | Acetylation | Uniprot | |
| K267 | Acetylation | Uniprot | |
| K270 | Acetylation | Uniprot | |
| S285 | Phosphorylation | Uniprot | |
| S301 | Phosphorylation | Uniprot | |
| S304 | Phosphorylation | Uniprot | |
| S307 | Phosphorylation | Uniprot | |
| S331 | Phosphorylation | Uniprot | |
| S338 | Phosphorylation | Uniprot | |
| T351 | Phosphorylation | Uniprot | |
| S395 | Phosphorylation | Uniprot | |
| S427 | Phosphorylation | Uniprot | |
| Y429 | Phosphorylation | Uniprot | |
| S448 | Phosphorylation | Uniprot | |
| Y464 | Phosphorylation | Uniprot |
Research Backgrounds
Transcription factor that is involved in embryonic development, establishment of tissue-specific gene expression and regulation of gene expression in differentiated tissues. Is thought to act as a 'pioneer' factor opening the compacted chromatin for other proteins through interactions with nucleosomal core histones and thereby replacing linker histones at target enhancer and/or promoter sites. Binds DNA with the consensus sequence 5'-[AC]A[AT]T[AG]TT[GT][AG][CT]T[CT]-3' (By similarity). Proposed to play a role in translating the epigenetic signatures into cell type-specific enhancer-driven transcriptional programs. Its differential recruitment to chromatin is dependent on distribution of histone H3 methylated at 'Lys-5' (H3K4me2) in estrogen-regulated genes. Involved in the development of multiple endoderm-derived organ systems such as liver, pancreas, lung and prostate; FOXA1 and FOXA2 seem to have at least in part redundant roles (By similarity). Modulates the transcriptional activity of nuclear hormone receptors. Is involved in ESR1-mediated transcription; required for ESR1 binding to the NKX2-1 promoter in breast cancer cells; binds to the RPRM promoter and is required for the estrogen-induced repression of RPRM. Involved in regulation of apoptosis by inhibiting the expression of BCL2. Involved in cell cycle regulation by activating expression of CDKN1B, alone or in conjunction with BRCA1. Originally described as a transcription activator for a number of liver genes such as AFP, albumin, tyrosine aminotransferase, PEPCK, etc. Interacts with the cis-acting regulatory regions of these genes. Involved in glucose homeostasis.
Nucleus.
Highly expressed in prostate and ESR1-positive breast tumors. Overexpressed in esophageal and lung adenocarcinomas.
Binds DNA as a monomer (By similarity). Interacts with FOXA2. Interacts with NKX2-1. Interacts with HDAC7. Interacts with the histone H3-H4 heterodimer. Associates with nucleosomes containing histone H2A. Interacts with AR. Interacts with NR0B2 (By similarity).
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.