PBX3 Antibody - #DF8080

Product: | PBX3 Antibody |
Catalog: | DF8080 |
Description: | Rabbit polyclonal antibody to PBX3 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Chicken |
Mol.Wt.: | 47 kDa; 47kD(Calculated). |
Uniprot: | P40426 |
RRID: | AB_2841433 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8080, RRID:AB_2841433.
Fold/Unfold
Homeobox protein PBX3; MGC134053; OTTHUMP00000064213; Pbx 3; Pbx3; PBX3_HUMAN; Pre B cell leukemia homeobox 3; Pre B cell leukemia transcription factor 3; Pre-B-cell leukemia transcription factor 3; RP11 336P12.1;
Immunogens
- P40426 PBX3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDDQSRMLQTLAGVNLAGHSVQGGMALPPPPHGHEGADGDGRKQDIGDILHQIMTITDQSLDEAQAKKHALNCHRMKPALFSVLCEIKEKTGLSIRGAQEEDPPDPQLMRLDNMLLAEGVSGPEKGGGSAAAAAAAAASGGSSDNSIEHSDYRAKLTQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIRYKKNIGKFQEEANLYAAKTAVTAAHAVAAAVQNNQTNSPTTPNSGSSGSFNLPNSGDMFMNMQSLNGDSYQGSQVGANVQSQVDTLRHVINQTGGYSDGLGGNSLYSPHNLNANGGWQDATTPSSVTSPTEGPGSVHSDTSN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P40426 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S82 | Phosphorylation | Uniprot | |
K90 | Ubiquitination | Uniprot | |
S121 | Phosphorylation | Uniprot | |
K197 | Ubiquitination | Uniprot | |
S211 | Phosphorylation | Uniprot | |
S212 | Phosphorylation | Uniprot | |
Y307 | Phosphorylation | Uniprot |
Research Backgrounds
Transcriptional activator that binds the sequence 5'-ATCAATCAA-3'.
Nucleus.
Ubiquitously expressed.
Interacts with PBXIP1.
Belongs to the TALE/PBX homeobox family.
Research Fields
· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.
References
Application: WB Species: Human Sample: AML cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.