ATG4A Antibody - #DF8073
| Product: | ATG4A Antibody |
| Catalog: | DF8073 |
| Description: | Rabbit polyclonal antibody to ATG4A |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 45 kDa; 45kD(Calculated). |
| Uniprot: | Q8WYN0 |
| RRID: | AB_2841427 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8073, RRID:AB_2841427.
Fold/Unfold
AI627006; APG4 autophagy 4 homolog A; Apg4a; ATG4 autophagy related 4 homolog A (S. cerevisiae); ATG4 autophagy related 4 homolog A; ATG4A; ATG4A_HUMAN; Atg4al; AUT like 2 cysteine endopeptidase; AUT-like 2 cysteine endopeptidase; Autl2; Autophagin 2; Autophagin-2; Autophagy related 4A cysteine peptidase; Autophagy related cysteine endopeptidase 2; Autophagy related protein 4 homolog A; Autophagy-related cysteine endopeptidase 2; Autophagy-related protein 4 homolog A; AV169859; Cysteine protease ATG4A; hAPG4A; MGC107179;
Immunogens
Widely expressed, at a low level, and the highest expression is observed in skeletal muscle and brain. Also detected in fetal liver.
- Q8WYN0 ATG4A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKLLSDISARLWFTYRRKFSPIGGTGPSSDAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLDRKDCCYSIHQMAQMGVGEGKSIGEWFGPNTVAQVLKKLALFDEWNSLAVYVSMDNTVVIEDIKKMCRVLPLSADTAGDRPPDSLTASNQSKGTSAYCSAWKPLLLIVPLRLGINQINPVYVDAFKECFKMPQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTFHCLQSPQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEVTTTGAEFIDSTEQLEEFDLEEDFEILSV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q8WYN0 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S47 | Phosphorylation | Uniprot | |
| S100 | Phosphorylation | Uniprot | |
| Y111 | Phosphorylation | Uniprot | |
| K328 | Ubiquitination | Uniprot | |
| K339 | Ubiquitination | Uniprot | |
| K343 | Ubiquitination | Uniprot |
Research Backgrounds
Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Cleaves the C-terminal amino acid of ATG8 family proteins to reveal a C-terminal glycine. Exposure of the glycine at the C-terminus is essential for ATG8 proteins conjugation to phosphatidylethanolamine (PE) and insertion to membranes, which is necessary for autophagy. Preferred substrate is GABARAPL2 followed by MAP1LC3A and GABARAP. Has also an activity of delipidating enzyme for the PE-conjugated forms.
Cytoplasm.
Widely expressed, at a low level, and the highest expression is observed in skeletal muscle and brain. Also detected in fetal liver.
Belongs to the peptidase C54 family.
Research Fields
· Cellular Processes > Transport and catabolism > Autophagy - other. (View pathway)
· Cellular Processes > Transport and catabolism > Autophagy - animal. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.