UNG Antibody - #DF8057
Product: | UNG Antibody |
Catalog: | DF8057 |
Description: | Rabbit polyclonal antibody to UNG |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Dog, Chicken, Xenopus |
Mol.Wt.: | 35 kDa; 35kD(Calculated). |
Uniprot: | P13051 |
RRID: | AB_2841413 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8057, RRID:AB_2841413.
Fold/Unfold
DGU; DKFZp781L1143; HIGM 4; HIGM4; OTTHUMP00000240527; OTTHUMP00000240528; OTTHUMP00000240529; UDG; UNG 1; UNG 15; ung; UNG_HUMAN; UNG1; UNG15; UNG2; Uracil DNA glycosylase 1; Uracil DNA glycosylase 2; Uracil DNA glycosylase; Uracil-DNA glycosylase;
Immunogens
Isoform 1 is widely expressed with the highest expression in skeletal muscle, heart and testicles. Isoform 2 has the highest expression levels in tissues containing proliferating cells.
- P13051 UNG_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MIGQKTLYSFFSPSPARKRHAPSPEPAVQGTGVAGVPEESGDAAAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P13051 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K5 | Acetylation | Uniprot | |
K5 | Ubiquitination | Uniprot | |
T6 | Phosphorylation | Uniprot | |
Y8 | Phosphorylation | Uniprot | |
S9 | Phosphorylation | Uniprot | |
S12 | Phosphorylation | P24941 (CDK2) | Uniprot |
S14 | Phosphorylation | Uniprot | |
S23 | Phosphorylation | Uniprot | |
T31 | Phosphorylation | Uniprot | |
K49 | Ubiquitination | Uniprot | |
K50 | Ubiquitination | Uniprot | |
T60 | Phosphorylation | Uniprot | |
S63 | Phosphorylation | Uniprot | |
S64 | Phosphorylation | P06493 (CDK1) | Uniprot |
S67 | Phosphorylation | Uniprot | |
K78 | Ubiquitination | Uniprot | |
K100 | Ubiquitination | Uniprot | |
K108 | Ubiquitination | Uniprot | |
Y125 | Phosphorylation | Uniprot | |
T126 | Phosphorylation | Uniprot | |
Y128 | Phosphorylation | Uniprot | |
T188 | Phosphorylation | Uniprot | |
K261 | Ubiquitination | Uniprot | |
Y284 | Phosphorylation | Uniprot | |
K295 | Acetylation | Uniprot | |
K295 | Ubiquitination | Uniprot | |
K302 | Ubiquitination | Uniprot |
Research Backgrounds
Excises uracil residues from the DNA which can arise as a result of misincorporation of dUMP residues by DNA polymerase or due to deamination of cytosine.
Isoform 1 is processed by cleavage of a transit peptide.
Mitochondrion.
Nucleus.
Isoform 1 is widely expressed with the highest expression in skeletal muscle, heart and testicles. Isoform 2 has the highest expression levels in tissues containing proliferating cells.
Monomer. Interacts with FAM72A.
(Microbial infection) Interacts with HIV-1 Vpr.
Belongs to the uracil-DNA glycosylase (UDG) superfamily. UNG family.
Research Fields
· Genetic Information Processing > Replication and repair > Base excision repair.
· Human Diseases > Immune diseases > Primary immunodeficiency.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.