Product: CEACAM6 Antibody
Catalog: DF8029
Description: Rabbit polyclonal antibody to CEACAM6
Application: WB IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 37 kDa; 37kD(Calculated).
Uniprot: P40199
RRID: AB_2841397

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
CEACAM6 Antibody detects endogenous levels of total CEACAM6.
RRID:
AB_2841397
Cite Format: Affinity Biosciences Cat# DF8029, RRID:AB_2841397.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Carcinoembryonic antigen related cell adhesion molecule 6; Carcinoembryonic antigen related cell adhesion molecule 6 (non specific cross reacting antigen); Carcinoembryonic antigen-related cell adhesion molecule 6; CD 66c; CD66c; CD66c antigen; CEA LIKE PROTEIN; CEACAM 6; CEACAM6; CEAL; CEAM6_HUMAN; MGC93832; NCA; Non specific cross reacting antigen; Non-specific crossreacting antigen; Normal cross reacting antigen; Normal cross-reacting antigen;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P40199 CEAM6_HUMAN:

Expressed in neutrophils (PubMed:1378450). Expressed in columnar epithelial and goblet cells of the colon (PubMed:10436421). Expressed in numerous tumor cell lines (at protein level) (PubMed:16204051).

Sequence:
MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI

PTMs - P40199 As Substrate

Site PTM Type Enzyme
N197 N-Glycosylation
N224 N-Glycosylation
S243 Phosphorylation
S304 Phosphorylation
T312 Phosphorylation
S326 Phosphorylation
T330 Phosphorylation

Research Backgrounds

Function:

Cell surface glycoprotein that plays a role in cell adhesion and tumor progression. Intercellular adhesion occurs in a calcium- and fibronectin-independent manner. Mediates homophilic and heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM5 and CEACAM8. Heterophilic interaction with CEACAM8 occurs in activated neutrophils. Plays a role in neutrophil adhesion to cytokine-activated endothelial cells. Plays a role as an oncogene by promoting tumor progression; positively regulates cell migration, cell adhesion to endothelial cells and cell invasion. Also involved in the metastatic cascade process by inducing gain resistance to anoikis of pancreatic adenocarcinoma and colorectal carcinoma cells.

PTMs:

Glycosylated.

Subcellular Location:

Cell membrane>Lipid-anchor. Apical cell membrane. Cell surface.
Note: Localized to the apical glycocalyx surface.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in neutrophils. Expressed in columnar epithelial and goblet cells of the colon. Expressed in numerous tumor cell lines (at protein level).

Subunit Structure:

Homodimer; homodimerizes via its Ig-like V-type domain. Heterodimer with CEACAM8; heterodimerizes via its Ig-like V-type domain.

Family&Domains:

The extracellular N-terminus Ig-like V-type domain is necessary for homophilic and heterophilic intercellular adhesion.

Belongs to the immunoglobulin superfamily. CEA family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.