Product: SMN1 Antibody
Catalog: DF8020
Description: Rabbit polyclonal antibody to SMN1
Application: WB IHC IF/ICC
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Prediction: Bovine, Dog
Mol.Wt.: 32 kDa(Observed); 32kD(Calculated).
Uniprot: Q16637
RRID: AB_2841391

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Prediction:
Bovine(80%), Dog(%)
Clonality:
Polyclonal
Specificity:
SMN1 Antibody detects endogenous levels of total SMN1.
RRID:
AB_2841391
Cite Format: Affinity Biosciences Cat# DF8020, RRID:AB_2841391.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

BCD541; Component of gems 1; Gemin 1; Gemin-1; OTTHUMP00000125198; OTTHUMP00000223567; OTTHUMP00000223568; OTTHUMP00000224066; OTTHUMP00000226924; SMA 1; SMA 2; SMA 3; SMA 4; SMA; SMA@; SMA1; SMA2; SMA3; SMA4; SMN; SMN_HUMAN; SMN1; SMN2; SMNT; Survival motor neuron protein; Survival of motor neuron 1, telomeric; T-BCD541;

Immunogens

Immunogen:

A synthesized peptide derived from human SMN1, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
Q16637 SMN_HUMAN:

Expressed in a wide variety of tissues. Expressed at high levels in brain, kidney and liver, moderate levels in skeletal and cardiac muscle, and low levels in fibroblasts and lymphocytes. Also seen at high levels in spinal cord. Present in osteoclasts and mononuclear cells (at protein level).

Sequence:
MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Dog
100
Bovine
80
Pig
0
Horse
0
Sheep
0
Xenopus
0
Zebrafish
0
Chicken
0
Rabbit
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

The SMN complex plays a catalyst role in the assembly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Thereby, plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP. In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assembly of the core snRNP. Dissociation by the SMN complex of CLNS1A from the trapped Sm proteins and their transfer to an SMN-Sm complex triggers the assembly of core snRNPs and their transport to the nucleus. Ensures the correct splicing of U12 intron-containing genes that may be important for normal motor and proprioceptive neurons development. Also required for resolving RNA-DNA hybrids created by RNA polymerase II, that form R-loop in transcription terminal regions, an important step in proper transcription termination. May also play a role in the metabolism of small nucleolar ribonucleoprotein (snoRNPs).

Subcellular Location:

Nucleus>Gem. Nucleus>Cajal body. Cytoplasm. Cytoplasmic granule. Perikaryon. Cell projection>Neuron projection. Cell projection>Axon. Cytoplasm>Myofibril>Sarcomere>Z line.
Note: Colocalizes with actin and at the Z-line of skeletal muscle (By similarity). Under stress conditions colocalizes with RPP20/POP7 in punctuated cytoplasmic granules (PubMed:14715275). Colocalized and redistributed with ZPR1 from the cytoplasm to nuclear gems (Gemini of coiled bodies) and Cajal bodies (PubMed:11283611). Colocalizes with FMR1 in cytoplasmic granules in the soma and neurite cell processes (PubMed:18093976).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in a wide variety of tissues. Expressed at high levels in brain, kidney and liver, moderate levels in skeletal and cardiac muscle, and low levels in fibroblasts and lymphocytes. Also seen at high levels in spinal cord. Present in osteoclasts and mononuclear cells (at protein level).

Family&Domains:

The Tudor domain mediates association with dimethylarginines, which are common in snRNP proteins.

Belongs to the SMN family.

Research Fields

· Genetic Information Processing > Translation > RNA transport.

References

1). Morusin Alleviates Aortic Valve Calcification by Inhibiting Valve Interstitial Cell Senescence Through Ccnd1/Trim25/Nrf2 Axis. Advanced science (Weinheim, Baden-Wurttemberg, Germany), 2024 (PubMed: 38502885) [IF=15.1]

Application: WB    Species: human    Sample: VICs

Figure 5 Morusin alleviates the senescence of VICs through CCND1/Nrf2 pathway. A) VICs were transfected with CCND1 siRNA or scrambled siRNA, and then stimulated with OM for 7 days. Immunoblot analysis of Nrf2 expression in VICs from indicated groups (n = 3, each group). Bar plots showing the semiquantitative analysis of Nrf2 expression. B) Heatmap for NRF2, NQO1, and HMXO-1 in OM + morusin versus OM groups. C–E) Immunoblot analysis of NRF2 and HMXO-1 expression in VICs from indicated groups (n = 3, each group). Bar plots showing the fold change of indicated genes expression over control. F–H) Immunofluorescent staining of NRF2 (red), DCFH-DC (green), and DAPI (blue) in the VICs from indicated groups (n = 3, each group). Bar plots showing the semiquantitative analysis of fluorescence intensity. Scale bar 50 µm. I,J) Representative images showing MitoSOX (red) staining and quantification of the fluorescence intensity of MitoSOX fluorescence in VICs from indicated groups (n = 3, each group). Data are mean ± SD. *p < 0.05; **p < 0.01; ***p < 0.001 (ANOVA with Tukey's multiple comparisons test).

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.