PSMD14 Antibody - #DF8011
Product: | PSMD14 Antibody |
Catalog: | DF8011 |
Description: | Rabbit polyclonal antibody to PSMD14 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat, Monkey |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 35 kDa; 35kD(Calculated). |
Uniprot: | O00487 |
RRID: | AB_2841387 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8011, RRID:AB_2841387.
Fold/Unfold
26S proteasome non-ATPase regulatory subunit 14; 26S proteasome regulatory subunit rpn11; 26S proteasome-associated PAD1 homolog 1; 26S proteasome-associated PAD1 homolog; PAD1; PAD1, yeast, homolog of; POH1; Proteasome (prosome, macropain) 26S subunit, non-ATPase, 14; Proteasome 26S subunit non ATPase 14; PSDE_HUMAN; Psmd14; RPN11; Testis tissue sperm binding protein Li 69n;
Immunogens
- O00487 PSDE_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O00487 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y32 | Phosphorylation | Uniprot | |
S34 | Phosphorylation | Uniprot | |
K43 | Ubiquitination | Uniprot | |
K94 | Ubiquitination | Uniprot | |
S150 | Phosphorylation | Uniprot | |
K152 | Ubiquitination | Uniprot | |
K154 | Ubiquitination | Uniprot | |
T177 | Phosphorylation | Uniprot | |
S179 | Phosphorylation | Uniprot | |
K186 | Ubiquitination | Uniprot | |
K209 | Ubiquitination | Uniprot | |
K215 | Ubiquitination | Uniprot | |
K222 | Ubiquitination | Uniprot | |
K223 | Ubiquitination | Uniprot | |
S224 | Phosphorylation | Uniprot | |
Y234 | Phosphorylation | Uniprot | |
C238 | S-Nitrosylation | Uniprot | |
K239 | Ubiquitination | Uniprot | |
K246 | Ubiquitination | Uniprot | |
K253 | Ubiquitination | Uniprot | |
K257 | Ubiquitination | Uniprot | |
K264 | Ubiquitination | Uniprot | |
T266 | Phosphorylation | Uniprot | |
K273 | Ubiquitination | Uniprot | |
K277 | Ubiquitination | Uniprot |
Research Backgrounds
Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair. The PSMD14 subunit is a metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains within the complex. Plays a role in response to double-strand breaks (DSBs): acts as a regulator of non-homologous end joining (NHEJ) by cleaving 'Lys-63'-linked polyubiquitin, thereby promoting retention of JMJD2A/KDM4A on chromatin and restricting TP53BP1 accumulation. Also involved in homologous recombination repair by promoting RAD51 loading.
Widely expressed. Highest levels in heart and skeletal muscle.
Component of the 19S proteasome regulatory particle complex. The 26S proteasome consists of a 20S core particle (CP) and two 19S regulatory subunits (RP). The regulatory particle is made of a lid composed of 9 subunits including PSMD4, a base containing 6 ATPases and few additional components. Within the complex, PSMD4 interacts with subunit PSMD7 through their respective MPN domain. Interacts with TXNL1.
Belongs to the peptidase M67A family. PSMD14 subfamily.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > Proteasome.
· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.