MESDC2 Antibody - #DF7971
Product: | MESDC2 Antibody |
Catalog: | DF7971 |
Description: | Rabbit polyclonal antibody to MESDC2 |
Application: | WB IHC |
Reactivity: | Human, Mouse |
Prediction: | Zebrafish, Bovine, Chicken |
Mol.Wt.: | 26 kDa; 26kD(Calculated). |
Uniprot: | Q14696 |
RRID: | AB_2841361 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7971, RRID:AB_2841361.
Fold/Unfold
BOCA; KIAA0081; LDLR chaperone MESD; MESD; MESD_HUMAN; MESDC 2; mesdc2; Mesoderm development candidate 2; Mesoderm development protein; Renal carcinoma antigen NY REN 61; Renal carcinoma antigen NY-REN-61;
Immunogens
- Q14696 MESD_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAASRWARKAVVLLCASDLLLLLLLLPPPGSCAAEGSPGTPDESTPPPRKKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPVDFSKIDPSKPESILKMTKKGKTLMMFVTVSGSPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVGQDRCADVTLEGQVYPGKGGGSKEKNKTKQDKGKKKKEGDLKSRSSKEENRAGNKREDL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q14696 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y58 | Phosphorylation | Uniprot | |
K72 | Ubiquitination | Uniprot | |
K85 | Ubiquitination | Uniprot | |
S88 | O-Glycosylation | Uniprot | |
S88 | Phosphorylation | Uniprot | |
K95 | Methylation | Uniprot | |
T113 | Phosphorylation | Uniprot | |
S121 | Phosphorylation | Uniprot | |
S123 | Phosphorylation | Uniprot | |
T125 | Phosphorylation | Uniprot | |
R179 | Methylation | Uniprot | |
K207 | Ubiquitination | Uniprot | |
K209 | Ubiquitination | Uniprot | |
K210 | Ubiquitination | Uniprot | |
K211 | Ubiquitination | Uniprot |
Research Backgrounds
Chaperone specifically assisting the folding of beta-propeller/EGF modules within the family of low-density lipoprotein receptors (LDLRs). Acts as a modulator of the Wnt pathway through chaperoning the coreceptors of the canonical Wnt pathway, LRP5 and LRP6, to the plasma membrane. Essential for specification of embryonic polarity and mesoderm induction. Plays an essential role in neuromuscular junction (NMJ) formation by promoting cell-surface expression of LRP4 (By similarity). May regulate phagocytosis of apoptotic retinal pigment epithelium (RPE) cells (By similarity).
Endoplasmic reticulum.
Note: Released from apoptotic cells and shed photoreceptor outer segments.
Monomer. Interacts with LRP5; the interaction prevents LRP5 from forming aggregates and chaperones LRP6 to the plasma membrane. Interacts with LRP6; the interaction prevents LRP6 from forming aggregates and chaperones LRP6 to the plasma membrane. Interacts with LRP4; the interaction promotes glycosylation of LRP4 and its cell-surface expression (By similarity).
The chaperone domain provides a folding template for proper folding of the beta-propeller (BP) domains of LRP5/6.
The escort domain ensures LRP5/6 safe-trafficking from the ER to the Golgi by preventing premature ligand-binding.
Belongs to the MESD family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.