BRCC3 Antibody - #DF7942
| Product: | BRCC3 Antibody |
| Catalog: | DF7942 |
| Description: | Rabbit polyclonal antibody to BRCC3 |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Chicken, Xenopus |
| Mol.Wt.: | 36 kDa; 36kD(Calculated). |
| Uniprot: | P46736 |
| RRID: | AB_2841348 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7942, RRID:AB_2841348.
Fold/Unfold
BRCA1-A complex subunit BRCC36; BRCA1/BRCA2 containing complex subunit 3; BRCA1/BRCA2 containing complex subunit 36; BRCA1/BRCA2-containing complex subunit 3; BRCA1/BRCA2-containing complex subunit 36; Brcc3; BRCC3_HUMAN; BRCC36; BRISC complex subunit BRCC36; C6.1A; Chromosome X open reading frame 53; CXorf53; Lys-63-specific deubiquitinase BRCC36; OTTHUMP00000061450;
Immunogens
Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Aberrantly expressed in the vast majority of breast tumors.
- P46736 BRCC3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDTRSDSKFAYTGTEMRTVAEKVDAVRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSESLHGPRDFWSSSQHISIEGQKEEERYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELMQELSSLE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P46736 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K51 | Ubiquitination | Uniprot | |
| Y54 | Phosphorylation | Uniprot | |
| T55 | Phosphorylation | Uniprot | |
| K65 | Ubiquitination | Uniprot | |
| K180 | Ubiquitination | Uniprot | |
| S199 | Phosphorylation | Uniprot | |
| K204 | Ubiquitination | Uniprot | |
| K226 | Ubiquitination | Uniprot | |
| S231 | Phosphorylation | Uniprot | |
| K237 | Ubiquitination | Uniprot | |
| Y247 | Phosphorylation | Uniprot | |
| S252 | Phosphorylation | Uniprot | |
| T254 | Phosphorylation | Uniprot | |
| S258 | Phosphorylation | Uniprot | |
| K261 | Ubiquitination | Uniprot | |
| S313 | Phosphorylation | Uniprot | |
| S314 | Phosphorylation | Uniprot |
Research Backgrounds
Metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains. Does not have activity toward 'Lys-48'-linked polyubiquitin chains. Component of the BRCA1-A complex, a complex that specifically recognizes 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs). In the BRCA1-A complex, it specifically removes 'Lys-63'-linked ubiquitin on histones H2A and H2AX, antagonizing the RNF8-dependent ubiquitination at double-strand breaks (DSBs). Catalytic subunit of the BRISC complex, a multiprotein complex that specifically cleaves 'Lys-63'-linked ubiquitin in various substrates. Mediates the specific 'Lys-63'-specific deubiquitination associated with the COP9 signalosome complex (CSN), via the interaction of the BRISC complex with the CSN complex. The BRISC complex is required for normal mitotic spindle assembly and microtubule attachment to kinetochores via its role in deubiquitinating NUMA1. Plays a role in interferon signaling via its role in the deubiquitination of the interferon receptor IFNAR1; deubiquitination increases IFNAR1 activity by enhancing its stability and cell surface expression. Down-regulates the response to bacterial lipopolysaccharide (LPS) via its role in IFNAR1 deubiquitination.
Nucleus. Cytoplasm. Cytoplasm>Cytoskeleton>Spindle pole.
Note: Localizes at sites of DNA damage at double-strand breaks (DSBs) (PubMed:20656690, PubMed:26344097). Interaction with ABRAXAS2 retains BRCC3 in the cytoplasm (PubMed:20656690).
Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Aberrantly expressed in the vast majority of breast tumors.
Component of the ARISC complex, at least composed of UIMC1/RAP80, ABRAXAS1, BRCC3/BRCC36, BABAM2 and BABAM1/NBA1. Component of the BRCA1-A complex, at least composed of BRCA1, BARD1, UIMC1/RAP80, ABRAXAS1, BRCC3/BRCC36, babam2 and BABAM1/NBA1. In the BRCA1-A complex, interacts directly with ABRAXAS1 and babam2. Component of the BRISC complex, at least composed of ABRAXAS2, BRCC3/BRCC36, BABAM2 and BABAM1/NBA1. Identified in a complex with SHMT2 and the other subunits of the BRISC complex. In the BRISC complex, interacts directly with ABRAXAS2. Identified in a complex with ABRAXAS2 and NUMA1. The BRISC complex interacts with the CSN complex. Component of the BRCA1/BRCA2 containing complex (BRCC), which also contains BRCA1, BRCA2, BARD1, BABAM2 and RAD51. BRCC is a ubiquitin E3 ligase complex that enhances cellular survival following DNA damage. Interacts with BRCA1. Binds polyubiquitin.
Belongs to the peptidase M67A family. BRCC36 subfamily.
Research Fields
· Genetic Information Processing > Replication and repair > Homologous recombination.
· Organismal Systems > Immune system > NOD-like receptor signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.