TMPRSS2 Antibody - #DF7917

Product: | TMPRSS2 Antibody |
Catalog: | DF7917 |
Description: | Rabbit polyclonal antibody to TMPRSS2 |
Application: | WB IHC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Horse, Dog |
Mol.Wt.: | 54 kDa; 54kD(Calculated). |
Uniprot: | O15393 |
RRID: | AB_2841332 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7917, RRID:AB_2841332.
Fold/Unfold
D16Ertd61e; Epitheliasin; FLJ41954; MGC6821; PP9284; PRSS10; Serine protease 10; TMPRSS2; TMPRSS2 ERG FUSION GENE, INCLUDED; TMPRSS2 ETV1 FUSION GENE, INCLUDED; TMPS2_HUMAN; Transmembrane protease serine 2 catalytic chain; Transmembrane protease, serine 2; Transmembrane protease, serine 2, EC 3.4.219;
Immunogens
Highly expressed in prostate epithelial cells and in prostate cancers. Expressed in type II pneumocytes in the lung (at protein level). Expressed strongly in small intestine. Also expressed in colon, stomach and salivary gland.
- O15393 TMPS2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MALNSGSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O15393 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y44 | Phosphorylation | Uniprot | |
Y45 | Phosphorylation | Uniprot | |
Y52 | Phosphorylation | Uniprot | |
T58 | Phosphorylation | Uniprot | |
S61 | Phosphorylation | Uniprot | |
T341 | Phosphorylation | Uniprot |
Research Backgrounds
Serine protease that proteolytically cleaves and activates the viral spike glycoproteins which facilitate virus-cell membrane fusions; spike proteins are synthesized and maintained in precursor intermediate folding states and proteolysis permits the refolding and energy release required to create stable virus-cell linkages and membrane coalescence. Facilitates human SARS coronavirus (SARS-CoV) infection via two independent mechanisms, proteolytic cleavage of ACE2, which might promote viral uptake, and cleavage of coronavirus spike glycoprotein which activates the glycoprotein for cathepsin L-independent host cell entry. Proteolytically cleaves and activates the spike glycoproteins of human coronavirus 229E (HCoV-229E) and human coronavirus EMC (HCoV-EMC) and the fusion glycoproteins F0 of Sendai virus (SeV), human metapneumovirus (HMPV), human parainfluenza 1, 2, 3, 4a and 4b viruses (HPIV). Essential for spread and pathogenesis of influenza A virus (strains H1N1, H3N2 and H7N9); involved in proteolytic cleavage and activation of hemagglutinin (HA) protein which is essential for viral infectivity.
Proteolytically processed; by an autocatalytic mechanism.
Cell membrane>Single-pass type II membrane protein.
Secreted.
Note: Activated by cleavage and secreted.
Highly expressed in prostate epithelial cells and in prostate cancers. Expressed in type II pneumocytes in the lung (at protein level). Expressed strongly in small intestine. Also expressed in colon, stomach and salivary gland.
The catalytically active form interacts with ACE2.
Belongs to the peptidase S1 family.
Research Fields
· Human Diseases > Infectious diseases: Viral > Influenza A.
· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.
· Human Diseases > Cancers: Specific types > Prostate cancer. (View pathway)
References
Application: WB Species: Human Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.