CITED1 Antibody - #DF7903
(1)
(1)
| Product: | CITED1 Antibody |
| Catalog: | DF7903 |
| Description: | Rabbit polyclonal antibody to CITED1 |
| Application: | WB |
| Reactivity: | Human |
| Mol.Wt.: | 20 kDa; 20kD(Calculated). |
| Uniprot: | Q99966 |
| RRID: | AB_2841320 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7903, RRID:AB_2841320.
Fold/Unfold
ABCC1; AI316840; AU019144; Cbp/p300-interacting transactivator 1; Cbp/p300-interacting transactivator with GLU/ASP-rich C-terminal domain, 1; Cbp/p300-interacting transactivator with Glu/Asp-rich carboxy-terminal domain 1; CITE1_HUMAN; CITED1; melanocyte specific gene 1; Melanocyte specific protein 1; Melanocyte-specific protein 1; MSG1;
Immunogens
- Q99966 CITE1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPTTSRPALDVKGGTSPAKEDANQEMSSVAYSNLAVKDRKAVAILHYPGVASNGTKASGAPTSSSGSPIGSPTTTPPTKPPSFNLHPAPHLLASMHLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC
PTMs - Q99966 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K37 | Acetylation | Uniprot | |
| S52 | Phosphorylation | Uniprot | |
| T55 | Phosphorylation | Uniprot | |
| S64 | Phosphorylation | Uniprot |
Research Backgrounds
Transcriptional coactivator of the p300/CBP-mediated transcription complex. Enhances SMAD-mediated transcription by strengthening the functional link between the DNA-binding SMAD transcription factors and the p300/CBP transcription coactivator complex. Stimulates estrogen-dependent transactivation activity mediated by estrogen receptors signaling; stabilizes the interaction of estrogen receptor ESR1 and histone acetyltransferase EP300. Positively regulates TGF-beta signaling through its association with the SMAD/p300/CBP-mediated transcriptional coactivator complex. Induces transcription from estrogen-responsive promoters and protection against cell death. Potentiates EGR2-mediated transcriptional activation activity from the ERBB2 promoter. Acts as an inhibitor of osteoblastic mineralization through a cAMP-dependent parathyroid hormone receptor signaling. May play a role in pigmentation of melanocytes. Associates with chromatin to the estrogen-responsive TGF-alpha promoter region in a estrogen-dependent manner.
Phosphorylated. Phosphorylation changes in a cell cycle-dependent manner and reduces its transcriptional coactivator activity.
Nucleus. Cytoplasm.
Note: Shuttles between the nucleus and the cytoplasm by a nuclear export signal and (NES) in a CRM1-dependent manner.
Expressed only in melanocytes and testis.
Interacts (via C-terminus) with CREBBP. Interacts with EGR2 (By similarity). Homodimer. Binds to RBM14. Interacts (via N-terminus) with HSPA8; the interaction suppresses the association of CITED1 with p300/CBP and SMAD-mediated transcription transactivation. Interacts (via C-terminus) with TOX3 (via HGM box); the interaction increases estrogen-response element (ERE)-dependent transcription and protection against cell death. Interacts with ESR1; the interaction occurs in a estrogen-dependent manner (By similarity). Interacts (unphosphorylated form preferentially and via C-terminus) with EP300.
Belongs to the CITED family.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.