ENTPD5 Antibody - #DF7901
Product: | ENTPD5 Antibody |
Catalog: | DF7901 |
Description: | Rabbit polyclonal antibody to ENTPD5 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Monkey |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 47 kDa; 48kD(Calculated). |
Uniprot: | O75356 |
RRID: | AB_2841318 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7901, RRID:AB_2841318.
Fold/Unfold
CD39 like 4; AI196558; AI987697; CD39 antigen like 4; CD39 antigen-like 4; CD39 like 4; CD39L4; Ectonucleoside triphosphate diphosphohydrolase 5; ENTP5_HUMAN; Entpd5; ER UDPase; ER-UDPase; GDPase ENTPD5; Guanosine-diphosphatase ENTPD5; MGC163357; MGC163359; mNTPase; NTPDase 5; Nucleoside diphosphatase; PCPH; Pcph proto oncogene protein; Proto oncogene CPH; UDPase ENTPD5; Uridine-diphosphatase ENTPD5;
Immunogens
Expressed in adult liver, kidney, prostate, testis and colon. Much weaker expression in other tissues.
- O75356 ENTP5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MATSWGTVFFMLVVSCVCSAVSHRNQQTWFEGIFLSSMCPINVSASTLYGIMFDAGSTGTRIHVYTFVQKMPGQLPILEGEVFDSVKPGLSAFVDQPKQGAETVQGLLEVAKDSIPRSHWKKTPVVLKATAGLRLLPEHKAKALLFEVKEIFRKSPFLVPKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQETVGTLDLGGASTQITFLPQFEKTLEQTPRGYLTSFEMFNSTYKLYTHSYLGFGLKAARLATLGALETEGTDGHTFRSACLPRWLEAEWIFGGVKYQYGGNQEGEVGFEPCYAEVLRVVRGKLHQPEEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQLTKKVNNIETGWALGATFHLLQSLGISH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O75356 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K98 | Acetylation | Uniprot | |
S227 | Phosphorylation | Uniprot | |
N232 | N-Glycosylation | Uniprot | |
T234 | Phosphorylation | Uniprot |
Research Backgrounds
Uridine diphosphatase (UDPase) that promotes protein N-glycosylation and ATP level regulation. UDP hydrolysis promotes protein N-glycosylation and folding in the endoplasmic reticulum, as well as elevated ATP consumption in the cytosol via an ATP hydrolysis cycle. Together with CMPK1 and AK1, constitutes an ATP hydrolysis cycle that converts ATP to AMP and results in a compensatory increase in aerobic glycolysis. The nucleotide hydrolyzing preference is GDP > IDP > UDP, but not any other nucleoside di-, mono- or triphosphates, nor thiamine pyrophosphate. Plays a key role in the AKT1-PTEN signaling pathway by promoting glycolysis in proliferating cells in response to phosphoinositide 3-kinase (PI3K) signaling.
N-glycosylated; high-mannose type (By similarity). Glycosylation is not essential for enzymatic activity.
Endoplasmic reticulum. Secreted.
Expressed in adult liver, kidney, prostate, testis and colon. Much weaker expression in other tissues.
Exists both as a monomer and a disulfide-linked homodimer, the dimers are enzymatically inactive.
Belongs to the GDA1/CD39 NTPase family.
Research Fields
· Metabolism > Nucleotide metabolism > Purine metabolism.
· Metabolism > Nucleotide metabolism > Pyrimidine metabolism.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.