AGR2 Antibody - #DF7855
| Product: | AGR2 Antibody |
| Catalog: | DF7855 |
| Description: | Rabbit polyclonal antibody to AGR2 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 20 kDa, 23,25 kDa; 20kD(Calculated). |
| Uniprot: | O95994 |
| RRID: | AB_2841289 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7855, RRID:AB_2841289.
Fold/Unfold
AG 2; AG 2 protein; AG-2; AG2; AG2 protein; AGR 2; AGR2; AGR2_HUMAN; Anterior gradient 2 homolog (Xenopus laevis); anterior gradient 2 homolog; Anterior gradient 2, protein disulphide isomerase family member; Anterior gradient 2, Xenopus, homolog of; Anterior gradient homolog 2; Anterior gradient protein 2 homolog; Epididymis secretory protein Li 116; GOB 4; GOB4; HAG 2; hAG-2; hAG2; HAG2/R; HEL S 116; HPC 8; hPC8; PDIA17; Protein disulfide isomerase family A member 17; secreted cement gland homolog; Secreted cement gland protein XAG 2 homolog; Secreted cement gland protein XAG-2 homolog; Secreted cement gland protein XAG2 homolog; XAG 2; XAG2;
Immunogens
A synthesized peptide derived from human AGR2, corresponding to a region within N-terminal amino acids.
Expressed strongly in trachea, lung, stomach, colon, prostate and small intestine. Expressed weakly in pituitary gland, salivary gland, mammary gland, bladder, appendix, ovary, fetal lung, uterus, pancreas, kidney, fetal kidney, testis, placenta, thyroid gland and in estrogen receptor (ER)-positive breast cancer cell lines.
- O95994 AGR2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Required for MUC2 post-transcriptional synthesis and secretion. May play a role in the production of mucus by intestinal cells (By similarity). Proto-oncogene that may play a role in cell migration, cell differentiation and cell growth. Promotes cell adhesion.
Secreted. Endoplasmic reticulum.
Expressed strongly in trachea, lung, stomach, colon, prostate and small intestine. Expressed weakly in pituitary gland, salivary gland, mammary gland, bladder, appendix, ovary, fetal lung, uterus, pancreas, kidney, fetal kidney, testis, placenta, thyroid gland and in estrogen receptor (ER)-positive breast cancer cell lines.
Belongs to the AGR family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.