VTCN1 Antibody - #DF7849
| Product: | VTCN1 Antibody |
| Catalog: | DF7849 |
| Description: | Rabbit polyclonal antibody to VTCN1 |
| Application: | WB |
| Reactivity: | Human, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 31 kDa; 31kD(Calculated). |
| Uniprot: | Q7Z7D3 |
| RRID: | AB_2841285 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7849, RRID:AB_2841285.
Fold/Unfold
B7 family member, H4; B7 H4; B7 homolog 4; B7 superfamily member 1; B7 superfamily, member 1; B7-H4; B7h.5; B7h4; B7S1; B7x; BC032925; Immune costimulatory protein B7-H4; Immune costimulatory protein B7H4; MGC41287; PRO1291; Protein B7S1; RP11 229A19.4; T cell costimulatory molecule B7x; T-cell costimulatory molecule B7x; V set domain-containing T cell activation inhibitor 1; V-set domain-containing T-cell activation inhibitor 1; VCTN1; Vtcn1; VTCN1_HUMAN;
Immunogens
Overexpressed in breast, ovarian, endometrial, renal cell (RCC) and non-small-cell lung cancers (NSCLC). Expressed on activated T- and B-cells, monocytes and dendritic cells, but not expressed in most normal tissues (at protein level). Widely expressed, including in kidney, liver, lung, ovary, placenta, spleen and testis.
- Q7Z7D3 VTCN1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q7Z7D3 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S114 | Phosphorylation | Uniprot | |
| S243 | Phosphorylation | Uniprot |
Research Backgrounds
Negatively regulates T-cell-mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. When expressed on the cell surface of tumor macrophages, plays an important role, together with regulatory T-cells (Treg), in the suppression of tumor-associated antigen-specific T-cell immunity. Involved in promoting epithelial cell transformation.
N-glycosylated.
Cell membrane>Single-pass type I membrane protein.
Note: Expressed at the cell surface. A soluble form has also been detected.
Overexpressed in breast, ovarian, endometrial, renal cell (RCC) and non-small-cell lung cancers (NSCLC). Expressed on activated T- and B-cells, monocytes and dendritic cells, but not expressed in most normal tissues (at protein level). Widely expressed, including in kidney, liver, lung, ovary, placenta, spleen and testis.
Belongs to the immunoglobulin superfamily. BTN/MOG family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cell adhesion molecules (CAMs). (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.