APBB1IP Antibody - #DF7836

(3)  
Product: APBB1IP Antibody
Catalog: DF7836
Description: Rabbit polyclonal antibody to APBB1IP
Application: WB IHC IF/ICC
Reactivity: Human, Mouse
Mol.Wt.: 100 kd; 73kD(Calculated).
Uniprot: Q7Z5R6
RRID: AB_2841276

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
IHC 1:50-1:200, WB 1:1000-3000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Polyclonal
Specificity:
APBB1IP Antibody detects endogenous levels of total APBB1IP.
RRID:
AB_2841276
Cite Format: Affinity Biosciences Cat# DF7836, RRID:AB_2841276.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

AB1IP; Amyloid beta A4 precursor protein binding family B member 1 interacting protein; Amyloid beta precursor protein binding family B member 1; APBB1 interacting protein 1; INAG1; OTTHUMP00000019344; PREL 1; PREL1; Proline rich EVH1 ligand 1; Proline rich protein 73; Rap1 GTP interacting adapter molecule; RAP1 interacting adaptor molecule; RARP 1; RARP1; Retinoic acid responsive proline rich protein 1;

Immunogens

Immunogen:
Uniprot:

Q7Z5R6(AB1IP_HUMAN) >>Visit HPA database.

Gene(ID):
APBB1IP(54518)
Expression:
Q7Z5R6 AB1IP_HUMAN:

Widely expressed with high expression in thymus, spleen, lymph node, bone marrow and peripheral leukocytes.

Sequence:
MGESSEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPRAEFNYSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATGISQYEDDLPPPPADPVLDLPLPPPPPEPLSQEEEEAQAKADKIKLALEKLKEAKVKKLVVKVHMNDNSTKSLMVDERQLARDVLDNLFEKTHCDCNVDWCLYEIYPELQIERFFEDHENVVEVLSDWTRDTENKILFLEKEEKYAVFKNPQNFYLDNRGKKESKETNEKMNAKNKESLLEESFCGTSIIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTSRDLACFIQFENVNIYYGTQHKMKYKAPTDYCFVLKHPQIQKESQYIKYLCCDDTRTLNQWVMGIRIAKYGKTLYDNYQRAVAKAGLASRWTNLGTVNAAAPAQPSTGPKTGTTQPNGQIPQATHSVSAVLQEAQRHAETSKDKKPALGNHHDPAVPRAPHAPKSSLPPPPPVRRSSDTSGSPATPLKAKGTGGGGLPAPPDDFLPPPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPPPAPAPAPVPDSARPPPAVAKRPPVPPKRQENPGHPGGAGGGEQDFMSDLMKALQKKRGNVS

PTMs - Q7Z5R6 As Substrate

Site PTM Type Enzyme
Y45 Phosphorylation
S55 Phosphorylation
K164 Ubiquitination
K169 Ubiquitination
K181 Ubiquitination
K190 Ubiquitination
K210 Ubiquitination
Y225 Phosphorylation
K254 Ubiquitination
K260 Ubiquitination
K268 Ubiquitination
Y274 Phosphorylation
Y331 Phosphorylation
S337 Phosphorylation
Y340 Phosphorylation
Y341 Phosphorylation
K375 Ubiquitination
Y380 Phosphorylation
K385 Ubiquitination
K391 Ubiquitination
K397 Ubiquitination
K421 Ubiquitination
K433 Ubiquitination
S525 Phosphorylation
S526 Phosphorylation
T528 Phosphorylation
S529 Phosphorylation
S531 Phosphorylation
T534 Phosphorylation
S652 Phosphorylation

Research Backgrounds

Function:

Appears to function in the signal transduction from Ras activation to actin cytoskeletal remodeling. Suppresses insulin-induced promoter activities through AP1 and SRE. Mediates Rap1-induced adhesion.

Subcellular Location:

Cell membrane>Peripheral membrane protein. Cell projection>Lamellipodium. Cell junction>Focal adhesion. Cytoplasm>Cytoskeleton.
Note: Colocalizes with ENA/VASP proteins at lamellipodia tips and focal adhesions, and F-actin at the leading edge. At the membrane surface, associates, via the PH domain, preferentially with the inositol phosphates, PtdIns(5)P and PtdIns(3)P. This binding appears to be necessary for the efficient interaction of the RA domain to Ras-GTPases (By similarity).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Widely expressed with high expression in thymus, spleen, lymph node, bone marrow and peripheral leukocytes.

Subunit Structure:

Interacts, through the N-terminal Pro-rich region, with the WW domain of APBB1. Interacts with RAP1A, PFN1, TLN1, VASP, VCL and ENAH.

Family&Domains:

The two Pro-rich regions are required for the suppression of AP1 transcription activity.

Belongs to the MRL family.

Research Fields

· Environmental Information Processing > Signal transduction > Rap1 signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Platelet activation.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.