TNFSF4 Antibody - #DF7816
Product: | TNFSF4 Antibody |
Catalog: | DF7816 |
Description: | Rabbit polyclonal antibody to TNFSF4 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Monkey |
Prediction: | Rabbit |
Mol.Wt.: | 21 kDa; 21kD(Calculated). |
Uniprot: | P23510 |
RRID: | AB_2841265 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7816, RRID:AB_2841265.
Fold/Unfold
CD 134L; CD 252; CD134; CD134 ligand; CD134L; CD252; CD252 antigen; glycoprotein 34 kd; Glycoprotein Gp34; GP34; OX-40L; OX40 antigen ligand; OX40 ligand; OX40L; TAX transcriptionally-activated glycoprotein 1; TNFL4_HUMAN; Tnfsf4; Tumor necrosis factor (ligand) superfamily member 4; Tumor necrosis factor ligand superfamily member 4; TXGP1;
Immunogens
- P23510 TNFL4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P23510 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y56 | Phosphorylation | Uniprot | |
N152 | N-Glycosylation | Uniprot |
Research Backgrounds
Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.
Membrane>Single-pass type II membrane protein.
Homotrimer.
Belongs to the tumor necrosis factor family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.