GNB2 Antibody - #DF7783
Product: | GNB2 Antibody |
Catalog: | DF7783 |
Description: | Rabbit polyclonal antibody to GNB2 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 35 kDa; 37kD(Calculated). |
Uniprot: | P62879 |
RRID: | AB_2841244 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7783, RRID:AB_2841244.
Fold/Unfold
G protein beta 2 subunit; G protein subunit beta 2; G protein subunit beta-2; GBB2_HUMAN; Gnb2; Gnb2l1; Guanine nucleotide binding protein beta 2 subunit; Guanine nucleotide binding protein G I G S G T beta 2 subunit 2; Guanine nucleotide binding protein G protein beta polypeptide 2; Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2; OTTHUMP00000174601; OTTHUMP00000174602; RACK1; Receptor for activated C kinase; Receptor of activated protein kinase C 1; Signal transducing guanine nucleotide binding regulatory protein beta; Transducin beta chain 2;
Immunogens
- P62879 GBB2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P62879 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S2 | Acetylation | Uniprot | |
S2 | Phosphorylation | Uniprot | |
R15 | Methylation | Uniprot | |
K23 | Ubiquitination | Uniprot | |
C25 | S-Nitrosylation | Uniprot | |
T29 | Phosphorylation | Uniprot | |
T50 | Phosphorylation | Uniprot | |
K57 | Acetylation | Uniprot | |
K57 | Ubiquitination | Uniprot | |
S67 | Phosphorylation | Uniprot | |
S72 | Phosphorylation | Uniprot | |
S74 | Phosphorylation | Uniprot | |
K78 | Acetylation | Uniprot | |
Y85 | Phosphorylation | Uniprot | |
K89 | Ubiquitination | Uniprot | |
S136 | Phosphorylation | Uniprot | |
C204 | S-Nitrosylation | Uniprot | |
S207 | Phosphorylation | Uniprot | |
K209 | Ubiquitination | Uniprot | |
S216 | Phosphorylation | Uniprot | |
Y239 | Phosphorylation | Uniprot | |
K301 | Ubiquitination | Uniprot | |
C317 | S-Nitrosylation | Uniprot |
Research Backgrounds
Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.
Cytoplasm>Perinuclear region.
G proteins are composed of 3 units, alpha, beta and gamma. Interacts with ARHGEF18 and RASD2. Interacts with ATXN10. Interacts with SCN8A.
Belongs to the WD repeat G protein beta family.
Research Fields
· Environmental Information Processing > Signal transduction > Ras signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Apelin signaling pathway. (View pathway)
· Human Diseases > Substance dependence > Morphine addiction.
· Human Diseases > Substance dependence > Alcoholism.
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Organismal Systems > Immune system > Chemokine signaling pathway. (View pathway)
· Organismal Systems > Environmental adaptation > Circadian entrainment.
· Organismal Systems > Nervous system > Retrograde endocannabinoid signaling. (View pathway)
· Organismal Systems > Nervous system > Glutamatergic synapse.
· Organismal Systems > Nervous system > Cholinergic synapse.
· Organismal Systems > Nervous system > Serotonergic synapse.
· Organismal Systems > Nervous system > GABAergic synapse.
· Organismal Systems > Nervous system > Dopaminergic synapse.
· Organismal Systems > Endocrine system > Relaxin signaling pathway.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.