SOAT1 Antibody - #DF7778
Product: | SOAT1 Antibody |
Catalog: | DF7778 |
Description: | Rabbit polyclonal antibody to SOAT1 |
Application: | WB IHC |
Reactivity: | Human, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 65 kDa; 65kD(Calculated). |
Uniprot: | P35610 |
RRID: | AB_2841242 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7778, RRID:AB_2841242.
Fold/Unfold
ACACT; ACAT; ACAT-1; ACAT1; Acyl coenzyme A cholesterol acyltransferase 1; Acyl-coenzyme A:cholesterol acyltransferase 1; Cholesterol acyltransferase 1; SOAT; SOAT1; SOAT1_HUMAN; STAT; Sterol O acyltransferase 1; Sterol O-acyltransferase 1;
Immunogens
- P35610 SOAT1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEELKPFFMKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSVLEGEKNNHRAKDLRAPPEQGKIFIARRSLLDELLEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFSLLSYAFGKFPTVVWTWWIMFLSTFSVPYFLFQHWATGYSKSSHPLIRSLFHGFLFMIFQIGVLGFGPTYVVLAYTLPPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRNPTVRWGYVAMKFAQVFGCFFYVYYIFERLCAPLFRNIKQEPFSARVLVLCVFNSILPGVLILFLTFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVHDWLYYYAYKDFLWFFSKRFKSAAMLAVFAVSAVVHEYALAVCLSFFYPVLFVLFMFFGMAFNFIVNDSRKKPIWNVLMWTSLFLGNGVLLCFYSQEWYARQHCPLKNPTFLDYVRPRSWTCRYVF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P35610 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
S8 | Phosphorylation | Uniprot | |
S14 | Phosphorylation | Uniprot | |
S16 | Phosphorylation | Uniprot | |
K31 | Ubiquitination | Uniprot | |
S33 | Phosphorylation | Uniprot | |
T36 | Phosphorylation | Uniprot | |
S38 | Phosphorylation | Uniprot | |
K45 | Ubiquitination | Uniprot | |
K62 | Ubiquitination | Uniprot | |
K67 | Ubiquitination | Uniprot | |
S71 | Phosphorylation | Uniprot | |
K83 | Ubiquitination | Uniprot | |
K104 | Ubiquitination | Uniprot | |
K120 | Ubiquitination | Uniprot | |
K283 | Ubiquitination | Uniprot | |
K353 | Ubiquitination | Uniprot | |
K531 | Ubiquitination | Uniprot |
Research Backgrounds
Catalyzes the formation of fatty acid-cholesterol esters, which are less soluble in membranes than cholesterol. Plays a role in lipoprotein assembly and dietary cholesterol absorption. In addition to its acyltransferase activity, it may act as a ligase.
Endoplasmic reticulum membrane>Multi-pass membrane protein.
May form homo- or heterodimers. Interacts with UBIAD1.
Belongs to the membrane-bound acyltransferase family. Sterol o-acyltransferase subfamily.
Research Fields
· Metabolism > Lipid metabolism > Steroid biosynthesis.
· Organismal Systems > Digestive system > Cholesterol metabolism.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.