OAS1 Antibody | Affinity Biosciences

1/1

Western blot analysis of OAS1 using HuvEc whole lysates.

Product:	OAS1 Antibody
Catalog:	DF7760
Description:	Rabbit polyclonal antibody to OAS1
Application:	WB
Reactivity:	Human, Mouse, Rat
Mol.Wt.:	46 kDa; 46kD(Calculated).
Uniprot:	P00973
RRID:	AB_2841226

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MS Report

HPLC Report

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:1000-3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat

Clonality:

Polyclonal

Specificity:

OAS1 Antibody detects endogenous levels of total OAS1.

RRID:

AB_2841226
Cite Format: Affinity Biosciences Cat# DF7760, RRID:AB_2841226.

Conjugate:

Unconjugated.

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

(2 5')oligo(A) synthetase 1; (2-5'')oligo(A) synthase 1; 2 5 Oligoadenylate Synthetase 1; 2 5' oligo A synthase 1; 2 5' oligo A synthetase 1; 2 5A synthase 1; 2 5A synthetase 1; 2' 5' oligo A synthetase 1; 2' 5' oligoadenylate synthetase 1 40/46kDa; 2' 5' oligoadenylate synthetase 1; 2' 5' oligoisoadenylate synthetase 1; 2''-5''-oligoadenylate synthase 1; 2'5' oligo A synthetase 1; 2'5' oligoadenylate synthetase 1; 2'5' oligoisoadenylate synthetase 1; 2-5A synthase 1; E18/E16; IFI 4; IFI4; OAS 1; OAS1; OAS1_HUMAN; OIAS; OIASI; p46/p42 OAS;

Immunogens

Immunogen:

Uniprot:

P00973(OAS1_HUMAN) >>Visit HPA database.

Gene(ID):

OAS1(4938)

Sequence:

P00973 OAS1_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL

PTMs - P00973 As Substrate

P00973

Site	PTM Type	Source
K10	Ubiquitination	Uniprot
K42	Acetylation	Uniprot
S49	Phosphorylation	Uniprot
S50	Phosphorylation	Uniprot
S116	Phosphorylation	Uniprot
K182	Ubiquitination	Uniprot
K199	Ubiquitination	Uniprot
K213	Ubiquitination	Uniprot
K220	Ubiquitination	Uniprot
Y271	Phosphorylation	Uniprot
K279	Ubiquitination	Uniprot
K314	Ubiquitination	Uniprot
Y362	Phosphorylation	Uniprot
Y367	Phosphorylation	Uniprot

Research Backgrounds

P00973_OAS1_HUMAN

Function:

Interferon-induced, dsRNA-activated antiviral enzyme which plays a critical role in cellular innate antiviral response. In addition, it may also play a role in other cellular processes such as apoptosis, cell growth, differentiation and gene regulation. Synthesizes higher oligomers of 2'-5'-oligoadenylates (2-5A) from ATP which then bind to the inactive monomeric form of ribonuclease L (RNase L) leading to its dimerization and subsequent activation. Activation of RNase L leads to degradation of cellular as well as viral RNA, resulting in the inhibition of protein synthesis, thus terminating viral replication. Can mediate the antiviral effect via the classical RNase L-dependent pathway or an alternative antiviral pathway independent of RNase L. The secreted form displays antiviral effect against vesicular stomatitis virus (VSV), herpes simplex virus type 2 (HSV-2), and encephalomyocarditis virus (EMCV) and stimulates the alternative antiviral pathway independent of RNase L.

Subcellular Location:

Cytoplasm. Mitochondrion. Nucleus. Microsome. Endoplasmic reticulum. Secreted.
Note: Associated with different subcellular fractions such as mitochondrial, nuclear, and rough/smooth microsomal fractions.

Subunit Structure:

Monomer. Homotetramer.

Family&Domains:

Belongs to the 2-5A synthase family.

Research Fields

· Human Diseases > Infectious diseases: Viral > Hepatitis C.

· Human Diseases > Infectious diseases: Viral > Measles.

· Human Diseases > Infectious diseases: Viral > Influenza A.

· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.

· Organismal Systems > Immune system > NOD-like receptor signaling pathway. (View pathway)

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

OAS1 Antibody - #DF7760