DIRA1 Antibody - #AF0516
| Product: | DIRA1 Antibody |
| Catalog: | AF0516 |
| Description: | Rabbit polyclonal antibody to DIRA1 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Bovine, Horse, Sheep, Dog |
| Mol.Wt.: | 22kDa; 22kD(Calculated). |
| Uniprot: | O95057 |
| RRID: | AB_2834402 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0516, RRID:AB_2834402.
Fold/Unfold
Di Ras1; DIRAS family GTP binding RAS like 1; Distinct subgroup of the Ras family member 1; FLJ42681; GBTS1; GTP binding protein Di Ras1; Ras related inhibitor of cell growth; RIG; Rig protein; Small GTP binding tumor suppressor 1;
Immunogens
- O95057 DIRA1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKCTLM
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O95057 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K29 | Ubiquitination | Uniprot | |
| S53 | Phosphorylation | Uniprot | |
| K180 | Ubiquitination | Uniprot |
Research Backgrounds
Displays low GTPase activity and exists predominantly in the GTP-bound form.
Cell membrane>Lipid-anchor>Cytoplasmic side.
Highly expressed in heart and brain.
Belongs to the small GTPase superfamily. Di-Ras family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.