POFUT2 Antibody - #AF0588
| Product: | POFUT2 Antibody |
| Catalog: | AF0588 |
| Description: | Rabbit polyclonal antibody to POFUT2 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Zebrafish, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 49kDa; 50kD(Calculated). |
| Uniprot: | Q9Y2G5 |
| RRID: | AB_2834400 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0588, RRID:AB_2834400.
Fold/Unfold
C21orf80; EC 2.4.1.221; FUT 13; FUT13; GDP fucose protein O fucosyltransferase 2; GDP-fucose protein O-fucosyltransferase 2; KIAA0958; O FucT 2; O-FucT-2; OFucT2; OFUT2_HUMAN; Peptide O fucosyltransferase 2; Peptide-O-fucosyltransferase 2; POFUT 2; POFUT2; Protein O fucosyltransferase 2;
Immunogens
Isoform A is expressed in fetal liver and peripheral blood lymphocytes. Isoform B is expressed in spleen, lung, testis, bone marrow, thymus, pancreas, prostate, fetal brain, fetal liver and fetal kidney. Isoform C is expressed in brain, heart, spleen, liver, lung, stomach, testis, placenta, skin, thymus, pancreas, mammary gland, prostate, fetal brain, fetal liver and fetal heart.
- Q9Y2G5 OFUT2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MATLSFVFLLLGAVSWPPASASGQEFWPGQSAADILSGAASRRRYLLYDVNPPEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVLQSYAEGWKEGTWEEKVDERPCIDQLLYSQDKHEYYRGWFWGYEETRGLNVSCLSVQGSASIVAPLLLRNTSARSVMLDRAENLLHDHYGGKEYWDTRRSMVFARHLREVGDEFRSRHLNSTDDADRIPFQEDWMKMKVKLGSALGGPYLGVHLRRKDFIWGHRQDVPSLEGAVRKIRSLMKTHRLDKVFVATDAVRKEYEELKKLLPEMVRFEPTWEELELYKDGGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREILGLDPKTTYNRFCGDQEKACEQPTHWKITY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9Y2G5 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y182 | Phosphorylation | Uniprot | |
| T185 | Phosphorylation | Uniprot | |
| N189 | N-Glycosylation | Uniprot | |
| S191 | Phosphorylation | Uniprot | |
| S194 | Phosphorylation | Uniprot | |
| N259 | N-Glycosylation | Uniprot |
Research Backgrounds
Catalyzes the reaction that attaches fucose through an O-glycosidic linkage to a conserved serine or threonine residue in the consensus sequence C1-X(2,3)-S/T-C2-X(2)-G of thrombospondin type 1 repeats where C1 and C2 are the first and second cysteines, respectively. O-fucosylates members of several protein families including the ADAMTS family, the thrombosporin (TSP) and spondin families. The O-fucosylation of TSRs is also required for restricting epithelial to mesenchymal transition (EMT), maintaining the correct patterning of mesoderm and localization of the definite endoderm (By similarity). Required for the proper secretion of ADAMTS family members such as ADAMSL1 and ADAMST13.
Endoplasmic reticulum. Golgi apparatus.
Note: Mainly located in the endoplasmic reticulum.
Isoform A is expressed in fetal liver and peripheral blood lymphocytes. Isoform B is expressed in spleen, lung, testis, bone marrow, thymus, pancreas, prostate, fetal brain, fetal liver and fetal kidney. Isoform C is expressed in brain, heart, spleen, liver, lung, stomach, testis, placenta, skin, thymus, pancreas, mammary gland, prostate, fetal brain, fetal liver and fetal heart.
Belongs to the glycosyltransferase 68 family.
Research Fields
· Metabolism > Glycan biosynthesis and metabolism > Other types of O-glycan biosynthesis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.