Flt3 ligand Antibody - #DF7676
Product: | Flt3 ligand Antibody |
Catalog: | DF7676 |
Description: | Rabbit polyclonal antibody to Flt3 ligand |
Application: | WB IF/ICC |
Reactivity: | Human, Rat |
Mol.Wt.: | 26 kDa; 26kD(Calculated). |
Uniprot: | P49771 |
RRID: | AB_2841148 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7676, RRID:AB_2841148.
Fold/Unfold
FL; Flt 3 ligand; Flt 3L; Flt3 L; FLT3 LG; Flt3 ligand; Flt3L; FLT3L_HUMAN; Flt3lg; Fms related tyrosine kinase 3 ligand; Fms-related tyrosine kinase 3 ligand; SL cytokine;
Immunogens
- P49771 FLT3L_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQDLLLVEH
PTMs - P49771 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K142 | Ubiquitination | Uniprot |
Research Backgrounds
Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.
Cell membrane>Single-pass type I membrane protein.
Secreted.
Homodimer (isoform 2).
Research Fields
· Environmental Information Processing > Signal transduction > MAPK signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Ras signaling pathway. (View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway. (View pathway)
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Organismal Systems > Immune system > Hematopoietic cell lineage. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.