CYTH3 Antibody - #DF7653
Product: | CYTH3 Antibody |
Catalog: | DF7653 |
Description: | Rabbit polyclonal antibody to CYTH3 |
Application: | WB IHC |
Reactivity: | Human |
Prediction: | Pig, Bovine, Horse, Dog, Chicken |
Mol.Wt.: | 46 kDa; 46kD(Calculated). |
Uniprot: | O43739 |
RRID: | AB_2841129 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7653, RRID:AB_2841129.
Fold/Unfold
CYTH3; ARF nucleotide-binding site opener 3; ARNO3; ARNO3 protein; CYH3_HUMAN; Cyth3; Cytohesin-3; General receptor of phosphoinositides 1; Grp1; PH; PH, SEC7 and coiled-coil domain-containing protein 3; Protein ARNO3; PSCD3; SEC7 and coiled-coil domain-containing protein 3; SEC7 homolog C; Sec7-3; Sec7c;
Immunogens
- O43739 CYH3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEESKTTQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGERDEFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFIAMNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O43739 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K32 | Ubiquitination | Uniprot | |
K107 | Ubiquitination | Uniprot | |
K164 | Ubiquitination | Uniprot | |
K244 | Ubiquitination | Uniprot | |
K249 | Ubiquitination | Uniprot | |
K273 | Ubiquitination | Uniprot | |
Y359 | Phosphorylation | Uniprot | |
S362 | Phosphorylation | Uniprot | |
S375 | Phosphorylation | Uniprot | |
Y386 | Phosphorylation | Uniprot | |
T391 | Phosphorylation | Uniprot |
Research Backgrounds
Promotes guanine-nucleotide exchange on ARF1 and ARF6. Promotes the activation of ARF factors through replacement of GDP with GTP. Plays a role in the epithelial polarization (By similarity).
Cytoplasm>Cytosol. Cell membrane>Peripheral membrane protein. Cell junction>Adherens junction. Cell junction>Tight junction.
Note: Translocates from the cytosol to membranes enriched in phosphatidylinositol 3,4,5-trisphosphate.
Almost absent from liver, thymus and peripheral blood lymphocytes.
Interacts with GRASP (By similarity). Interacts with ARF6. Interacts with FRMD4A (By similarity). Interacts with FRMD4B (By similarity).
Binds via its PH domain to the inositol head group of phosphatidylinositol 3,4,5-trisphosphate.
Autoinhibited by its C-terminal basic region.
Research Fields
· Cellular Processes > Transport and catabolism > Endocytosis. (View pathway)
· Environmental Information Processing > Signal transduction > Phospholipase D signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.