BCL2A1 Antibody - #DF7652
(1)
(2)
| Product: | BCL2A1 Antibody |
| Catalog: | DF7652 |
| Description: | Rabbit polyclonal antibody to BCL2A1 |
| Application: | WB IF/ICC |
| Reactivity: | Human |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 29 kDa; 20kD(Calculated). |
| Uniprot: | Q16548 |
| RRID: | AB_2841128 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7652, RRID:AB_2841128.
Fold/Unfold
ACC 1; ACC 2; B2LA1_HUMAN; Bcl 2 related protein A1; Bcl-2-like protein 5; Bcl-2-related protein A1; BCL2 related protein A1; Bcl2-L-5; BCL2A1; BCL2L5; BFL1; GRS; HBPA1; Hematopoietic BCL2 related protein A1; Hemopoietic specific early response protein; Hemopoietic-specific early response protein; Protein BFL 1; Protein BFL-1; Protein GRS;
Immunogens
Seems to be restricted to the hematopoietic compartment. Expressed in peripheral blood, spleen, and bone marrow, at moderate levels in lung, small intestine and testis, at a minimal levels in other tissues. Also found in vascular smooth muscle cells and hematopoietic malignancies.
- Q16548 B2LA1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q16548 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S31 | Phosphorylation | Uniprot | |
| K50 | Acetylation | Uniprot | |
| T130 | Phosphorylation | Uniprot |
Research Backgrounds
Retards apoptosis induced by IL-3 deprivation. May function in the response of hemopoietic cells to external signals and in maintaining endothelial survival during infection (By similarity). Can inhibit apoptosis induced by serum starvation in the mammary epithelial cell line HC11 (By similarity).
Cytoplasm.
Seems to be restricted to the hematopoietic compartment. Expressed in peripheral blood, spleen, and bone marrow, at moderate levels in lung, small intestine and testis, at a minimal levels in other tissues. Also found in vascular smooth muscle cells and hematopoietic malignancies.
Interacts directly with BAK1, BID, BMF and BBC3 (By similarity). Interacts directly with BCL2L11/BIM. Interacts with BAX isoform Sigma. Interacts directly with PMAIP1. Interacts with RTL10/BOP. Interacts with ING4 (By similarity).
Belongs to the Bcl-2 family.
Research Fields
· Cellular Processes > Cell growth and death > Apoptosis. (View pathway)
· Environmental Information Processing > Signal transduction > NF-kappa B signaling pathway. (View pathway)
· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.
· Human Diseases > Cancers: Specific types > Acute myeloid leukemia. (View pathway)
References
Application: WB Species: Human Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.