ARF1 Antibody - #DF7650
| Product: | ARF1 Antibody |
| Catalog: | DF7650 |
| Description: | Rabbit polyclonal antibody to ARF1 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Zebrafish, Bovine, Sheep, Rabbit, Chicken, Xenopus |
| Mol.Wt.: | 20 kDa; 21kD(Calculated). |
| Uniprot: | P84077 |
| RRID: | AB_2841127 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7650, RRID:AB_2841127.
Fold/Unfold
ADP Ribosylation Factor 1; ADP-ribosylation factor 1; ARF 1; ARF1; ARF1_HUMAN;
Immunogens
- P84077 ARF1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P84077 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| M1 | Acetylation | Uniprot | |
| G2 | Acetylation | Uniprot | |
| G2 | Myristoylation | Uniprot | |
| Y35 | Phosphorylation | Uniprot | |
| K36 | Acetylation | Uniprot | |
| K36 | Ubiquitination | Uniprot | |
| K38 | Ubiquitination | Uniprot | |
| Y58 | Phosphorylation | Uniprot | |
| S62 | Phosphorylation | Uniprot | |
| K73 | Sumoylation | Uniprot | |
| K73 | Ubiquitination | Uniprot | |
| R117 | Methylation | Uniprot | |
| K127 | Ubiquitination | Uniprot | |
| T140 | Phosphorylation | Uniprot | |
| K142 | Acetylation | Uniprot | |
| K142 | Ubiquitination | Uniprot | |
| S147 | Phosphorylation | Uniprot | |
| Y167 | Phosphorylation | Uniprot |
Research Backgrounds
GTP-binding protein involved in protein trafficking among different compartments. Modulates vesicle budding and uncoating within the Golgi complex. Deactivation induces the redistribution of the entire Golgi complex to the endoplasmic reticulum, suggesting a crucial role in protein trafficking. In its GTP-bound form, its triggers the association with coat proteins with the Golgi membrane. The hydrolysis of ARF1-bound GTP, which is mediated by ARFGAPs proteins, is required for dissociation of coat proteins from Golgi membranes and vesicles. The GTP-bound form interacts with PICK1 to limit PICK1-mediated inhibition of Arp2/3 complex activity; the function is linked to AMPA receptor (AMPAR) trafficking, regulation of synaptic plasicity of excitatory synapses and spine shrinkage during long-term depression (LTD).
(Microbial infection) Functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase.
Demyristoylated by S.flexneri cysteine protease IpaJ which cleaves the peptide bond between N-myristoylated Gly-2 and Asn-3.
Golgi apparatus. Cytoplasm>Perinuclear region. Cell junction>Synapse>Synaptosome. Cell junction>Synapse>Postsynaptic density. Membrane>Lipid-anchor. Golgi apparatus>trans-Golgi network membrane>Lipid-anchor.
Interacts (when activated) with GGA1, GGA2 and GGA3; the interaction is required for proper subcellular location of GGA1, GGA2 and GGA3. Interacts with ARHGAP21, ASAP2, HERC1, PRKCABP, PIP5K1B, TMED2, PSCD2, TMED10 and GRIA2. Interacts with ARFGAP1, which hydrolyzes GTP and thus, regulates its function. Interacts with PI4KB in the Golgi complex. Interacts with NCS1/FREQ in the Golgi and at the plasma membrane. Interacts with PLEKHA3. Interacts with PLEKHA8; the interaction, together with phosphatidylinositol 4-phosphate binding, is required for FAPP2-mediated glucosylceramide transfer activity. Interacts (activated) with PICK1 (via PDZ domain); the interaction blocks Arp2/3 complex inhibition. Interacts with IQSEC1. Interacts with C9orf72 (By similarity).
Belongs to the small GTPase superfamily. Arf family.
Research Fields
· Cellular Processes > Transport and catabolism > Endocytosis. (View pathway)
· Environmental Information Processing > Signal transduction > Phospholipase D signaling pathway. (View pathway)
· Human Diseases > Infectious diseases: Bacterial > Vibrio cholerae infection.
· Human Diseases > Infectious diseases: Bacterial > Legionellosis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.