Glutamine Synthetase Antibody - #DF7607
![](/images/pubmed.gif)
Product: | Glutamine Synthetase Antibody |
Catalog: | DF7607 |
Description: | Rabbit polyclonal antibody to Glutamine Synthetase |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 42 kDa; 42kD(Calculated). |
Uniprot: | P15104 |
RRID: | AB_2841098 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7607, RRID:AB_2841098.
Fold/Unfold
cell proliferation-inducing protein 59; GLNA; GLNA_HUMAN; GLNS; GLUL; Glutamate ammonia ligase; Glutamate decarboxylase; Glutamate--ammonia ligase; glutamine synthase; Glutamine synthetase; GS; PIG 43; PIG 59; PIG43; PIG59; Proliferation inducing protein 43;
Immunogens
- P15104 GLNA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P15104 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T2 | Acetylation | Uniprot | |
K11 | Acetylation | Uniprot | |
K11 | Ubiquitination | Uniprot | |
K14 | Acetylation | Uniprot | |
K14 | Ubiquitination | Uniprot | |
Y17 | Phosphorylation | Uniprot | |
S19 | Phosphorylation | Uniprot | |
K25 | Ubiquitination | Uniprot | |
K52 | Ubiquitination | Uniprot | |
K91 | Ubiquitination | Uniprot | |
K95 | Ubiquitination | Uniprot | |
K103 | Acetylation | Uniprot | |
K103 | Ubiquitination | Uniprot | |
Y104 | Phosphorylation | Uniprot | |
Y180 | Phosphorylation | Uniprot | |
C183 | S-Nitrosylation | Uniprot | |
Y185 | Phosphorylation | Uniprot | |
K259 | Ubiquitination | Uniprot | |
K268 | Ubiquitination | Uniprot | |
Y269 | Phosphorylation | Uniprot | |
K276 | Ubiquitination | Uniprot | |
K291 | Ubiquitination | Uniprot | |
T301 | Phosphorylation | Uniprot | |
S320 | Phosphorylation | Uniprot | |
S322 | Phosphorylation | Uniprot | |
K334 | Ubiquitination | Uniprot | |
Y336 | Phosphorylation | Uniprot | |
S343 | Phosphorylation | Uniprot | |
C359 | S-Nitrosylation | Uniprot | |
Y371 | Phosphorylation | Uniprot | |
K372 | Acetylation | Uniprot | |
K372 | Ubiquitination | Uniprot |
Research Backgrounds
Glutamine synthetase that catalyzes the ATP-dependent conversion of glutamate and ammonia to glutamine. Its role depends on tissue localization: in the brain, it regulates the levels of toxic ammonia and converts neurotoxic glutamate to harmless glutamine, whereas in the liver, it is one of the enzymes responsible for the removal of ammonia (By similarity). Essential for proliferation of fetal skin fibroblasts. Independently of its glutamine synthetase activity, required for endothelial cell migration during vascular development: acts by regulating membrane localization and activation of the GTPase RHOJ, possibly by promoting RHOJ palmitoylation. May act as a palmitoyltransferase for RHOJ: able to autopalmitoylate and then transfer the palmitoyl group to RHOJ. Plays a role in ribosomal 40S subunit biogenesis.
Palmitoylated; undergoes autopalmitoylation.
Ubiquitinated by ZNRF1.
Cytoplasm>Cytosol. Microsome. Mitochondrion. Cell membrane>Lipid-anchor.
Note: Mainly localizes in the cytosol, with a fraction associated with the cell membrane.
Expressed in endothelial cells.
Decamer; composed of two pentamers. Interacts with PALMD (By similarity). Interacts with RHOJ.
Belongs to the glutamine synthetase family.
Research Fields
· Cellular Processes > Cell growth and death > Necroptosis. (View pathway)
· Metabolism > Amino acid metabolism > Arginine biosynthesis.
· Metabolism > Amino acid metabolism > Alanine, aspartate and glutamate metabolism.
· Metabolism > Carbohydrate metabolism > Glyoxylate and dicarboxylate metabolism.
· Metabolism > Energy metabolism > Nitrogen metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
· Metabolism > Global and overview maps > Biosynthesis of amino acids.
· Organismal Systems > Nervous system > Glutamatergic synapse.
· Organismal Systems > Nervous system > GABAergic synapse.
References
Application: IF/ICC Species: Human Sample: CRC tissues
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.